CAZyme Information: MGYG000001431_00856

Basic Information

• Species: Helicobacter pylori_BU
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter; Helicobacter pylori_BU
• CAZyme ID: MGYG000001431_00856
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367		42950.93	9.0754

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001431	1602443	Isolate	not provided	not provided

• Gene Location: Start: 4951; End: 6054 Strand: +

Full Sequence      

MDTQNLPDQIIPIFMSFDKNYALGAGVSLYSLLSHASRHTSAIDFSPLNQSNKLLPANIV
YKIHCLVKGVTLEQQNKLLKTLEPFKKFASLEFININSLDHSIESYLNESCSKRYGGLLV
LCRLLLASLFPNYSKIISIDVDTVFLGDVASAYFALDNDPTKLLGMVRDTFSHLPFEAFC
HFIERACKNFKIDFSRFSQNELKRIHQGFNMGFLVANLDLWRENGFEKIALEFLKNRGKD
LFYPEQCLINMVFWKRVLELPIYYNCYSDSFKEHYPKNIIMLHFIQYKPWRSVSSLNGRL
ICYEAEAGFWLANLFCTPFKNDFFKERLEMAKDQQMQSFKTHIRSKTIRDYFYFRIKNIL
KKVFKLS

Enzyme Prediction     

No EC number prediction in MGYG000001431_00856.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	11	292	1.6e-52	0.8754863813229572

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1442	RfaJ	1.72e-79	9	367	1	325	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01501	Glyco_transf_8	1.07e-51	12	292	1	250	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
cd04194	GT8_A4GalT_like	1.63e-44	11	292	1	248	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
cd00505	Glyco_transf_8	0.004	95	290	58	244	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
PRK15171	PRK15171	0.008	209	292	179	272	lipopolysaccharide 3-alpha-galactosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACI28087.1	3.44e-262	1	367	1	367
QEF41646.1	6.95e-262	1	365	1	365
BBI23500.1	2.83e-261	1	367	1	367
AVV96821.1	2.83e-261	1	367	1	367
SQJ11768.1	2.83e-261	1	367	1	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6U4B_A	2.53e-10	8	331	299	600	ChainA, WbbM protein [Klebsiella pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9AEU2	7.17e-06	207	291	149	239	Probable glycosyl transferase Gly OS=Streptococcus gordonii OX=1302 GN=gly PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001431_00856.