CAZyme Information: MGYG000001431_00935

Basic Information

• Species: Helicobacter pylori_BU
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter; Helicobacter pylori_BU
• CAZyme ID: MGYG000001431_00935
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372	MGYG000001431_36|CGC1	44534.24	7.2206

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001431	1602443	Isolate	not provided	not provided

• Gene Location: Start: 90336; End: 91454 Strand: -

Full Sequence      

MQHEIPIAFAFDKNYLKTGAVALYSLLDAHRAVEGVIFSIYVFYSGLKENDLNRLQETIK
PFKHFATLKCQDISTTLDSLPTITDSAWVNRYSRMILVKYLLPSLFPQYSKMIWSDVDVV
FCRAFADDFIALDTNESFHLSSVVSLQSQSVTEGFWFCNLDYMRKNSFSEQVLEKFKIQL
THPYFKEYTLIHHLHAYIRELPLHYSVLPYYYQEEPEDLRRKASLPIWFEIIHQDKPNEF
IYRQQIPYEISQIQDILSNPIIMHYESDKDALGIYNGKPWEFPLGNQYHLWLEMLAHTPF
WKDFTLEMQKKRVEYRDIAQKIHYFSQDKCLYEVSIHSIKVFASHYYNLVIKERWSKPIK
TFFQKIFFQKKF

Enzyme Prediction     

No EC number prediction in MGYG000001431_00935.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	2	282	2.8e-33	0.8871595330739299

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1442	RfaJ	2.19e-72	3	370	1	325	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
cd04194	GT8_A4GalT_like	1.59e-19	5	237	1	245	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
pfam01501	Glyco_transf_8	2.45e-14	6	174	1	181	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANH41686.1	4.18e-261	1	372	1	372
ADO07810.1	6.92e-260	1	372	1	372
AFX91930.1	1.40e-259	1	372	1	372
ADI35640.1	1.40e-259	1	372	1	372
AFH98709.1	8.73e-258	1	372	1	370

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001431_00935.