CAZyme Information: MGYG000001432_00196

Basic Information

• Species: Helicobacter_C cinaedi
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter_C; Helicobacter_C cinaedi
• CAZyme ID: MGYG000001432_00196
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351	MGYG000001432_1|CGC2	38560.51	9.6188

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001432	2240130	Isolate	not provided	not provided

• Gene Location: Start: 206996; End: 208051 Strand: -

Full Sequence      

MFAITGGGTGGHLAIAKALAQELKTQNLKAIYIGSTLGQDKAWFEKSDLFMQCYFLESSG
VVNKSGFNKLKALWKQFQATLEARKILKAHKVAHIISVGGFSAGGASMGAILARIPLFIH
EQNAIKGKLNEILTPFAKAVFGSFSSNSKNFIHTSYPVRDEFFTTSRIRQECKNILFLGG
SQGAKGINDFALKLTPLLLQKGINVAHQCGERDFERVKQEYENLGILHKVDLFAFDKNLV
TRLQQADICIARSGASSLWEMAANGLIGIFVPYPFAAKDHQYFNAKSFTGEGLGFVIREN
EINIESVLGFIESLQGEILEQKSSQVMSKIKPNGAREILDHINALAPIAKD

Enzyme Prediction     

No EC number prediction in MGYG000001432_00196.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	175	317	4e-38	0.8662420382165605

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	9.50e-115	1	346	3	355	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
TIGR01133	murG	2.32e-101	1	342	2	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
cd03785	GT28_MurG	1.78e-100	1	341	1	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	1.24e-89	1	346	2	355	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
pfam04101	Glyco_tran_28_C	2.78e-38	174	342	1	166	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAM31450.1	3.40e-254	1	351	1	351
QOQ90380.1	3.40e-254	1	351	1	351
BAM11520.1	3.96e-253	1	351	1	351
BBB19037.1	3.96e-253	1	351	1	351
QOQ96549.1	9.33e-252	1	351	1	351

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D1I_A	1.63e-42	8	345	18	365	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
3S2U_A	1.38e-37	4	340	7	349	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	1.00e-31	4	346	11	354	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7U322	2.84e-180	1	345	1	347	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) OX=235279 GN=murG PE=3 SV=1
Q17WB5	2.71e-121	3	342	4	350	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Helicobacter acinonychis (strain Sheeba) OX=382638 GN=murG PE=3 SV=1
O25770	1.09e-120	2	342	3	350	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=murG PE=3 SV=1
Q9ZK59	1.09e-120	2	342	3	350	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Helicobacter pylori (strain J99 / ATCC 700824) OX=85963 GN=murG PE=3 SV=1
B2UUR4	6.26e-120	2	342	3	350	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Helicobacter pylori (strain Shi470) OX=512562 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001432_00196.