CAZyme Information: MGYG000001432_01217

Basic Information

• Species: Helicobacter_C cinaedi
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter_C; Helicobacter_C cinaedi
• CAZyme ID: MGYG000001432_01217
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
308		35577.43	6.4904

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001432	2240130	Isolate	not provided	not provided

• Gene Location: Start: 1190586; End: 1191512 Strand: -

Full Sequence      

MKILILKLGYSETLDPEISKIVSLGDVVRCSVVLEALKEKYPHSHITWLVAQEALPLVAQ
NKYIDRVLVWDEFVPFVLMKEQYDMVVNLEKLHGICALADIIQAWEKVGFRFNTQSGEYD
TYMQGFVAKNYIRDKESGSKTHDIWQKIIVEMVGCTWRNQEYSLGYVPKPKEHFVVGLNH
FVGSKWPTKAMGKNKWEQLAQRLDTLKLTYSWQQGMNNLYDYMDWIAGCDVLVSNDSLGV
HLALAMKKRVVVLFGPTSGEEIYLYDRGIALYPNAKLACMPCYKPYCEMDSHCMDFIEID
KIVEYILK

Enzyme Prediction     

No EC number prediction in MGYG000001432_01217.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	78	293	6.4e-22	0.9511111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	1.82e-28	2	306	1	275	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	4.64e-24	1	307	2	327	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
TIGR02193	heptsyl_trn_I	3.44e-11	2	265	1	291	lipopolysaccharide heptosyltransferase I. This family consists of examples of ADP-heptose:LPS heptosyltransferase I, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
TIGR02195	heptsyl_trn_II	1.07e-07	170	304	192	327	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
pfam01075	Glyco_transf_9	9.92e-06	218	290	173	244	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMS66650.1	3.09e-82	1	308	1	297
QWT48448.1	5.77e-76	2	299	16	309
QWT46223.1	5.77e-76	2	299	16	309
BBN90427.1	2.31e-75	2	299	16	309
QFY41873.1	9.67e-73	2	302	14	310

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001432_01217.