CAZyme Information: MGYG000001432_01896

Basic Information

• Species: Helicobacter_C cinaedi
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter_C; Helicobacter_C cinaedi
• CAZyme ID: MGYG000001432_01896
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
264		30767.91	9.2876

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001432	2240130	Isolate	not provided	not provided

• Gene Location: Start: 1783169; End: 1783963 Strand: -

Full Sequence      

MYLQWCEKNLHKVFSFPHIFGKVRFLNKFWKRRVLKNPKLINYFIKEQYDVNIGFLEGIS
TIYISQKQGGKKIGYIHISLKEIRNNKRDERETKAYLELDSIICVSHYVKQSLLELYPEL
AHKHIEVIHNPVDKDLILQKSQAPLSQVKQRFTFLQVGRLTHQKGLDVLLQANKVLQDKG
LEYELWLLGEGERYKKELDSMIEAQGVKNVKFLGFCENPYPYIKMCDCMVLASYYEGYGL
VLAEACVLGKAIIASDTHKQGNFT

Enzyme Prediction     

No EC number prediction in MGYG000001432_01896.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	147	257	3.6e-22	0.7

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03811	GT4_GT28_WabH-like	1.57e-52	22	257	59	294	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03820	GT4_AmsD-like	1.02e-33	26	256	65	286	amylovoran biosynthesis glycosyltransferase AmsD and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. AmSD in Erwinia amylovora has been shown to be involved in the biosynthesis of amylovoran, the acidic exopolysaccharide acting as a virulence factor. This enzyme may be responsible for the formation of galactose alpha-1,6 linkages in amylovoran.
cd03801	GT4_PimA-like	9.43e-32	100	257	142	299	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03808	GT4_CapM-like	2.35e-29	100	257	141	295	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.
COG0438	RfaB	6.12e-27	14	257	55	308	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBB20703.1	3.19e-197	1	264	1	264
BAM33115.1	3.19e-197	1	264	1	264
QOQ97171.1	3.19e-197	1	264	1	264
QOQ91811.1	3.19e-197	1	264	1	264
BAM12846.1	3.65e-196	1	264	29	292

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2BFW_A	5.03e-06	153	255	38	145	Structureof the C domain of glycogen synthase from Pyrococcus abyssi [Pyrococcus abyssi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58459	5.17e-15	94	256	140	307	Uncharacterized glycosyltransferase MJ1059 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1059 PE=3 SV=1
Q0P9C7	1.93e-12	120	261	165	300	N-acetylgalactosamine-N,N'-diacetylbacillosaminyl-diphospho-undecaprenol 4-alpha-N-acetylgalactosaminyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglJ PE=1 SV=1
A7TZT2	1.26e-09	82	255	177	364	Mannosylfructose-phosphate synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=mfpsA PE=1 SV=1
P9WMY8	2.40e-07	59	256	134	323	Glycogen synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3116 PE=3 SV=1
P9WMY9	2.40e-07	59	256	134	323	Glycogen synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3032 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001432_01896.