CAZyme Information: MGYG000001433_00004

Basic Information

• Species: Bacteroides salyersiae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides salyersiae
• CAZyme ID: MGYG000001433_00004
• CAZy Family: GT11
• CAZyme Description: O-antigen biosynthesis glycosyltransferase WbnK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
273	MGYG000001433_1|CGC1	32738.54	8.0224

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001433	5309986	Isolate	not provided	not provided

• Gene Location: Start: 2423; End: 3244 Strand: -

Full Sequence      

MKQTIIMSGGLGNQMFQYALYCSMREKGIRVKIDISLYEFNRMHNGYMLDYAFGLNISHN
KINKYSVLWTRLIRSNRAPFLLFREDESRFCDDVFTTYKPYIDGCWIDERYFFNIKKKII
SQFSFHNIDQKNLMVANMMKVCNSVSLHIRRGDYLSQSMYNICNESYYKSAIEYIISRVE
DSKFFIFSDDPEWCKYFMEKFNVDYEIIQHNFGKDSYKDMYLMTQCKHNIIANSTFSWWG
AWLNNNAGKNVVCPSVWINGRDFNPCLEEWYHI

Enzyme Prediction     

No EC number prediction in MGYG000001433_00004.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	4	272	2.5e-68	0.9855072463768116

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	7.95e-61	6	265	6	263	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	3.18e-25	2	248	32	270	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCA50514.1	6.54e-95	1	270	1	270
AIT08976.1	1.14e-65	3	273	2	280
SNX52916.1	1.60e-64	9	264	8	275
QLK80744.1	1.47e-58	9	259	8	266
QCQ48037.1	1.47e-58	9	259	8	266

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58YV9	1.19e-26	7	273	5	302	O-antigen biosynthesis glycosyltransferase WbnK OS=Escherichia coli OX=562 GN=wbnK PE=1 SV=1
Q866E1	1.49e-10	4	252	83	324	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Alouatta belzebul OX=30590 GN=FUT1 PE=3 SV=1
Q866D6	3.63e-10	4	252	82	323	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Leontopithecus chrysomelas OX=57374 GN=FUT1 PE=3 SV=1
Q866C5	3.65e-10	111	252	174	324	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Plecturocebus brunneus OX=1812042 GN=FUT1 PE=3 SV=1
Q866F0	3.65e-10	111	252	174	324	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Saimiri boliviensis boliviensis OX=39432 GN=FUT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000084	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001433_00004.