CAZyme Information: MGYG000001433_00371

Basic Information

• Species: Bacteroides salyersiae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides salyersiae
• CAZyme ID: MGYG000001433_00371
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
723	MGYG000001433_1|CGC8	83342.24	5.4373

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001433	5309986	Isolate	not provided	not provided

• Gene Location: Start: 447794; End: 449965 Strand: +

Full Sequence      

MRSFFLTCFSIVWVFFTGACTGTSGSTDIVTPAKHVIERQIGEKVNGISFQQINPVDGKE
TFEIEAKEGKLTLKGSSTVALCYAFHTYLREACHSMKTWSGEHLELPSLWPDYSLRKQTT
PYDFRYFLNVCTYGYTTPYWDWARWENEIDWMALRGVNMPLATVASEAIAERVWLQMGLT
KEETREFFTAPAHLPWHRMGNLNTWDGPLSDEWQKSQIELQHQIINRMRELGMQPIAPAF
AGFVPMAFAEKHPDIKFKHLKWGGFDDKFNAYVLPPDSPFFEEIGKRFVKEWEKEFGKNT
YYLSDSFNEMELPVAKDDVEGKHKLLAQYGESIYRSITAGNPDAIWVTQGWTFGYQHDFW
DKASLQALLSHVPDDKMIIIDLGNDYPKWVWGTEQTWKVHDGFYGKKWIFSYVPNFGGKT
PLTGDLQMYATSSAEALKAPSHGNLIGFGSAPEGLENNEVVYELLADMGWTDQAINPEQW
MPSYCTARYGAYPESMKNAWELFRKTAYSSLYSYPRFTWQTVIPDQRRISKIDVSDDFLH
GIELFLASADSLNRSKLYVNDAIEFASYYIAAQADKLYKQALTEDTAGKPVAAHQHLNQA
IDLLLNVDKLLASHPLYRLEEWVELARNSGTTPAEKDAYEANAKRLITTWGGFQEDYAAR
FWSGLIKDYYIPRLKLYFSKQRGDLDNWEEEWIRTPWHNTTTPFEKPLDMAIELVQKAKE
IKN

Enzyme Prediction     

No EC number prediction in MGYG000001433_00371.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	68	708	3.6e-209	0.9834087481146304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	8.33e-174	125	472	1	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	1.58e-44	480	711	1	257	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	9.25e-27	31	111	1	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT77130.1	0.0	1	723	1	723
AHF12618.1	0.0	1	720	1	721
QRM99889.1	0.0	20	720	18	718
ALJ47490.1	0.0	20	720	18	718
QRQ58948.1	0.0	20	720	18	718

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	9.41e-122	70	679	51	657	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	3.99e-85	34	686	175	829	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	4.56e-85	34	686	183	837	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	4.08e-84	34	686	198	852	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54802	1.33e-120	70	679	74	680	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
Q9FNA3	3.76e-113	58	693	76	771	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000022	0.012330	0.987654	0.000004	0.000006	0.000005

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001433_00371.