CAZyme Information: MGYG000001433_00498

Basic Information

• Species: Bacteroides salyersiae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides salyersiae
• CAZyme ID: MGYG000001433_00498
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
776	MGYG000001433_1|CGC9	88383.64	7.3197

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001433	5309986	Isolate	not provided	not provided

• Gene Location: Start: 592663; End: 594993 Strand: -

Full Sequence      

MKNKIIYLLLFCTCLALPGQAQQFKTFEVGKKTFLLNGEPFIVKAAELHYTRIPQPYWEH
RIKMCKALGMNTICLYVFWNIHEQEEGQFDFTGQNDIAAFCRLAQKHGMYVIVRPGPYVC
AEWEMGGLPWWLLKKKDIALRTLDPYYMERVGIFMKKVGEQLVPLQITRGGNIIMVQVEN
EYGSYGTDKPYVSAIRDMVRGAGFTEVPLFQCDWSSNFTNNALDDLLWTVNFGTGANIDQ
QFKKLKELRPETPLMCSEFWSGWFDHWGRKHETRPAKDMVQGLKDMLDRNISFSLYMTHG
GTTFGHWGGANNPAYSAMCSSYDYDAPISEAGWATEKYFLLRDLLKGYLPAGQSLPTIPE
ALPVMEIPEIKFTQVAPLFSNLPVAKQAIDIQPMEQFDQGWGSILYRTVLPQDVKAGTVL
EITEVHDWAQVFANNTLLARLDRRKGEFTVTLPALKKGTQLDILVEAMGRVNFDKSIHDR
KGITESVVLAATDGNKQIVKNWQVYNLPVDYAFASNKQYVSGGKQAMPAYYKATFKLSKT
DDTFLDMSTWGKGMVWVNGHAMGRFWEIGPQQTLFMPGCWLKKGVNEIIVLDLKGPEKAM
VKGLKKPILDVLREKAPETHRKEGEHLNLSAETPAHKGAFIPGNGWQEVRFANPVKGRYF
CLEALSPQAEDNIAAIAEFDVLGDDGKPVSREHWKIRYADSEETRSGNRTADKIFDLQES
TFWMTVDNVAYPHQLVIDLDKEQTLTGFRYLPRAEKGYPGMIKEYRIYVKPTDFKY

Enzyme Prediction     

No EC number prediction in MGYG000001433_00498.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	34	346	4.1e-120	0.993485342019544

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	5.49e-173	33	346	1	316	Glycosyl hydrolases family 35.
PLN03059	PLN03059	1.63e-51	31	606	34	726	beta-galactosidase; Provisional
COG1874	GanA	3.71e-48	32	603	6	600	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam02449	Glyco_hydro_42	1.77e-10	58	183	12	139	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
pfam00754	F5_F8_type_C	1.61e-07	699	769	2	70	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT77306.1	0.0	1	776	1	776
QUU07353.1	0.0	1	776	1	778
ASM65425.1	0.0	1	776	1	778
QQT78041.1	0.0	1	776	1	778
QRP56715.1	0.0	1	776	1	778

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EON_A	0.0	1	775	1	778	GalactanaseBT0290 [Bacteroides thetaiotaomicron VPI-5482]
3D3A_A	4.53e-313	26	625	7	605	Crystalstructure of a beta-galactosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4MAD_A	1.66e-142	33	593	23	578	ChainA, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]
4E8C_A	9.28e-122	27	609	4	587	Crystalstructure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8C_B Crystal structure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8D_A Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4],4E8D_B Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4]
7KDV_A	5.06e-121	25	594	14	607	ChainA, Beta-galactosidase [Mus musculus],7KDV_C Chain C, Beta-galactosidase [Mus musculus],7KDV_E Chain E, Beta-galactosidase [Mus musculus],7KDV_G Chain G, Beta-galactosidase [Mus musculus],7KDV_I Chain I, Beta-galactosidase [Mus musculus],7KDV_K Chain K, Beta-galactosidase [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48982	3.28e-127	9	576	9	573	Beta-galactosidase OS=Xanthomonas manihotis OX=43353 GN=bga PE=1 SV=1
Q58D55	8.27e-123	25	621	29	650	Beta-galactosidase OS=Bos taurus OX=9913 GN=GLB1 PE=2 SV=1
Q9TRY9	5.33e-121	9	609	17	645	Beta-galactosidase OS=Canis lupus familiaris OX=9615 GN=GLB1 PE=1 SV=3
P23780	2.27e-120	25	594	31	624	Beta-galactosidase OS=Mus musculus OX=10090 GN=Glb1 PE=1 SV=1
P16278	1.46e-119	5	609	12	644	Beta-galactosidase OS=Homo sapiens OX=9606 GN=GLB1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000265	0.998929	0.000308	0.000171	0.000151	0.000137

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001433_00498.