CAZyme Information: MGYG000001433_00960

Basic Information

• Species: Bacteroides salyersiae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides salyersiae
• CAZyme ID: MGYG000001433_00960
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
727	MGYG000001433_1|CGC25	83929.12	5.6441

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001433	5309986	Isolate	not provided	not provided

• Gene Location: Start: 1179868; End: 1182051 Strand: -

Full Sequence      

MKKIISFVGIAFYVAVLQAQTWIWYPGDYEIWLGNRMNNRRTERGAFFPPFWKTDSHYVV
IEFSKQVDLERAENIFITAEGKYNVKLDGKLQFGMPSTLTLPAGKHNLNIKVWNQATPPA
IYVEGKTIHSDSSWKVTYEDKEWIDESGKASDTSATVYMNAGYWNFDRADQRPSQFMLCR
EPLQAVSREKSSKGELLDFGKETFGYITFKNLSGNGSLSLYYGESKEEALDTAYCETLDR
IQLRAGKVIDLATNEISAAGDFCLGNSKAFRYVYIEKEPDVQFDNVGMEYEYLPVEYRGA
FRCNDEEVNRIWEVGAYTMHLTTREFFIDGIKRDRWVWSGDAIQSYLMNYYLFFDSDAVK
RTIWLLRGKDPVTSHSNTIMDYTFYWFLSIYHYYMYTGDKAFVAQIYPRMQTMMEYVLGR
TNENGMVEGLAGDWVFVDWADGYLDKKGELSFEQILLCKSLETMALCARLLDQQDDRDRY
SGMATSLRAKLEPFFWDDTRKAMVHNRIDGIQSKSVTRYSNMFSVIFGYSDAGKQEDIKQ
NVLLNDSILKITTPYMRFYELEALCALGEQELVMQEIKDYWGGMLREGATSFWEKYNPEE
TGTQHLAMYGRPYGKSLCHAWGASPIYLLGKYYLGVTPEEAGYREFRIAPNLGGLKWMEG
SVPTPNGDISVYMDTSHIKVKAGEGKGYLYFTSRKTPKSNIGKVEKLGGNQYRLRIDTKD
EVRVSYR

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	193	677	5.5e-113	0.9484126984126984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	5.54e-25	299	632	4	339	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	3.99e-06	635	671	1	38	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam06202	GDE_C	2.02e-05	377	502	81	217	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
pfam17167	Glyco_hydro_36	5.62e-04	363	497	108	248	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT77830.1	0.0	1	727	1	727
QUT70971.1	0.0	19	727	15	728
BCA50087.1	0.0	2	727	3	733
QNL37671.1	0.0	2	726	3	732
QUT38423.1	0.0	19	727	15	728

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	0.0	19	727	17	730	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	1.18e-50	196	667	440	910	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	5.91e-31	183	634	81	543	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF03	2.96e-09	394	671	577	853	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000473	0.998750	0.000214	0.000185	0.000181	0.000185

TMHMM  Annotations     

start	end
5	27