CAZyme Information: MGYG000001433_01007

Basic Information

• Species: Bacteroides salyersiae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides salyersiae
• CAZyme ID: MGYG000001433_01007
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399	MGYG000001433_1|CGC26	46035.5	7.6573

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001433	5309986	Isolate	not provided	not provided

• Gene Location: Start: 1282995; End: 1284194 Strand: -

Full Sequence      

MKRNLICKTFVIGALLCSVSLAAQKVSDKLPWSVRMTESEMIRCPESWQLDFQPKLKWDY
CHGLELGAMLDVYDTYGGKKIYDYALAYADTMIHDDGSIVTYKLHEYNIDRLNSGKFLFR
IYEESKDEKYKKAIDLLRSQLDTHPRNEDGGFWHKKIYPNQMWLDGIYMASPFYAEYAFR
NNRVKDYADVVNQFITVARHTYDPKNGLYRHACDVSRKERWADPVTGQSKHSWGRAMGWY
AMAFVDALDFIPKHEAGRDSMLVILNNIAEQVKRLQDPKTGLWYQVLDRSGDKGNYLESS
CSTMFVYSLFKAVRMGYIDSSYLDVALKGYKGILDNFIEVDKDGLVTITQACAVAGLGGK
NYRSGDYDYYINETIRSNDPKAVGPFIMASLEYERLQKK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	51	395	2.7e-122	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.03e-136	32	397	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	7.75e-105	52	396	28	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT77882.1	2.24e-306	1	399	1	399
QDO69177.1	2.39e-280	1	398	1	398
QUT93209.1	3.80e-277	1	398	1	398
ALJ61262.1	3.80e-277	1	398	1	398
QQA07820.1	1.16e-251	1	398	1	399

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.09e-117	58	396	23	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	5.58e-82	51	396	32	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.32e-81	51	396	22	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3K11_A	2.15e-18	141	396	178	413	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
3QWT_A	7.47e-16	24	334	31	329	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	3.06e-81	51	396	32	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	9.67e-44	169	392	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	9.67e-44	169	392	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001342	0.997316	0.000656	0.000239	0.000208	0.000187

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001433_01007.