CAZyme Information: MGYG000001433_01354

Basic Information

• Species: Bacteroides salyersiae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides salyersiae
• CAZyme ID: MGYG000001433_01354
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
972	MGYG000001433_1|CGC33	106136.44	4.5166

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001433	5309986	Isolate	not provided	not provided

• Gene Location: Start: 1714831; End: 1717749 Strand: -

Full Sequence      

MYKRFVTALLFPLCMGGGLYAQQLAFPGAEGYGRFAKGARASESPEIYHVTNLNDSGEGS
LRDAISKPNRVIIFDVSGIINIKSRLVFSKNLTIAGQTAPGDGITIYGNGVSFSASDNII
VRHLRMRMGLKGDSGKDAAGIANGSNMIFDHISAAWGLDENFSINWDDKGYEPYNITIQN
SIIGQGIMPHACGGLIQSNGGISLYRNLYIDNKTRNPKVKGLNQFVNNVVYNWGDGGCYI
LGDTDASSWGVITNNYFIKGPVAGTKAFVRAKPAFQVYQKGNMIDYNVDGVLNGYEATEE
DFLRDGSDPTSLNVTFVKSPEDFDFSNYSRRKLEGDQKIVVSTDAEKHPVIMGETTAVEA
YNWIVENAGASLPTRDEVDGYMVDELLSLGTKGALLNSESEVGLTNGVGNIFAGNRPLDT
DNDGIPDAWEEANGLDKNDPTDAVKMAANGYLNIENYINSIDGPVMDYVKYPTNVQLSSL
GTDNVSIKWQNNASESTALILEYSADNKTFTPVVLNTDVTTYKLESLTPNTTYYIRLKTV
NGELESLYSSVLEVTTRGVPIPPVASINPVPENASTISDYSTVRLSWENKTGVWAGTVSY
SVYLGKSATTMEKVVDATTQMAATVNVEPATTYYWRIDAKNALGANEGDVWSFTTGTKPE
RGKVAYYSFDETEGASLNNEFGTAAVAKNFTPEWVTGVRNNAVNFNTVNASFVQEHYDAL
ELGNESFSIECWFKSAGGSVDWYLLHKGSHADNSYEGATGRWFGIQYQKNSKNDRLTWAI
DDNVTKTDVNVTGATAKFFNDEWVHLVCVRDVDAKELRMYANGSLVASGTDKTGNIGTVE
RMAIGNCNTAYENGFQGLMDELSIYNEVLTAEEIADHYNTGTGIHSNRMDTPAAGLAYPM
PFADEFYIPVINVEDMPAQITIMNASGQVVHQVEVMVQGGMAHVKDVGKLPAGYYIYMLQ
LDGKTWVGKIVK

Enzyme Prediction     

No EC number prediction in MGYG000001433_01354.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	77	257	2.9e-52	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13385	Laminin_G_3	4.81e-18	722	875	14	151	Concanavalin A-like lectin/glucanases superfamily. This domain belongs to the Concanavalin A-like lectin/glucanases superfamily.
cd00063	FN3	4.05e-10	472	556	4	93	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.
smart00060	FN3	5.03e-09	472	546	4	83	Fibronectin type 3 domain. One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.
pfam00041	fn3	6.55e-08	472	549	3	85	Fibronectin type III domain.
TIGR04183	Por_Secre_tail	4.07e-06	897	972	1	71	Por secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber average twenty or more copies of a C-terminal domain, represented by this model, associated with sorting to the outer membrane and covalent modification.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT73817.1	0.0	1	972	1	972
QUT74519.1	3.86e-200	19	683	21	664
AZA85404.1	4.45e-192	3	965	8	990
AZA97511.1	4.45e-192	3	965	8	990
AZA59404.1	8.82e-192	3	965	8	990

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5B297	7.38e-121	10	461	10	410	Probable pectate lyase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyC PE=3 SV=1
B8NQQ7	5.28e-120	24	461	21	413	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
A1DPF0	1.07e-119	24	461	22	414	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1
Q0CLG7	1.56e-118	24	461	21	413	Probable pectate lyase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyC PE=3 SV=1
B0XMA2	4.45e-118	24	461	22	414	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002596	0.994999	0.001628	0.000261	0.000240	0.000237

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001433_01354.