CAZyme Information: MGYG000001433_01620

Basic Information

• Species: Bacteroides salyersiae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides salyersiae
• CAZyme ID: MGYG000001433_01620
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
975		110739.85	6.2291

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001433	5309986	Isolate	not provided	not provided

• Gene Location: Start: 2079066; End: 2081993 Strand: -

Full Sequence      

MILRKYLCFACAVLFIQSGYAKEQKPINLGETPWRFSKVVRQEMDLAKDARILCGTQAVP
VINDGDMNTEWVANDAPEPSLLIDLHENKQTGKVKLSFKGNRVYFATVKVEVSLDNKQWN
SLTDGIDRQRCELYKEGDISSVNNTVGYVATVTSTSLSVPIPVTYRYIKLSGLKCFSEKK
EELPVRVSELAIHPVENDHPDQEMAGADFDDTRWEEVGIPHCYNEHDTYLNASTGERCWR
GEGWYRKKLFFNEKDREKEIFLEFQGVNLAAIVFVNGQAISGNTRVKQPGVVTHVGSSLP
FVVNISKYIKWGEENQIAIKVSNAKNTFFAWPGFGENEGFGQAMGGIVSPVYMHKKDKVH
IPFNSYSPLNKWGTYFGTVSATPQEAVVRFQTNVENSSEHTQAVELRTYLQDERGRTVLS
FTEQRNVAPGATHLFDRTETIQNPNLWYPIGCSGTPYLYTVQNKVYVDGKQVDSKSEKFG
IREITWDENHCYVNGEKCILRGFGNRNIYPGLGAAVPAALRWQDIAYIAECGGNAFRVGH
QPPFAEAFQACDVYGILLIVNSGDNEWALKNEPAKTYKREYDRDAIIAFRNHPSVVIWES
NNGLAYEGDKYLPSYTLEEVKKWDYIQPRLVLNRDGYPPEWDEKEPIVIGYTNRYEKVQG
HPSLNTEVYGTNWNGQPSWCIARFDYDNEKQFSQAYVQDYLHDLDRQACGWIDWMLAETY
GEGYTIYLNGMRNQKSLGSCAMDANRFPKLKYRIYQKALWVPFSKRPGVALQSHWNYSGI
QDVDAWSNCPYVELFINKKSYGIVEPDQATRRCTWKEIYWEPGIVEAVGLDYDKRPVCSE
KIESSDEPYVIQVTIEKQTAKPDGEEFVLRANASDAFIVTAKIVDKAGRWCPRADHLLKF
EVEGEGVYKGSYNFYVTEGKDLAYHAPGDHELQAEGGLMRVAVRTTFNPGKIKVKVSADG
LVSGEGSVKSKKVRL

Enzyme Prediction     

No EC number prediction in MGYG000001433_01620.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	203	724	2.1e-67	0.5611702127659575

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.38e-27	219	602	47	405	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	8.18e-27	195	598	25	412	beta-D-glucuronidase; Provisional
pfam18565	Glyco_hydro2_C5	1.28e-18	851	965	1	101	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
pfam00703	Glyco_hydro_2	1.37e-16	384	482	16	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10340	ebgA	2.10e-15	243	606	111	452	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT74086.1	0.0	1	975	1	975
ALK28947.1	1.28e-141	209	967	67	861
AJK44668.1	1.35e-141	209	967	92	886
AXF04603.1	1.94e-141	198	964	56	848
ALL71072.1	4.20e-141	198	964	36	828

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPD_A	5.23e-74	209	970	59	804	Thestructure of a beta-glucuronidase from glycoside hydrolase family 2 [Formosa agariphila KMM 3901]
4YPJ_A	2.74e-56	204	968	26	805	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
5T98_A	1.10e-54	203	968	40	818	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
7CWD_A	5.47e-50	202	968	21	799	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4CU6_A	9.54e-45	202	968	31	842	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4],4CU7_A Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4],4CU8_A Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KN75	2.58e-73	209	970	50	795	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
A7LXS9	4.12e-55	203	961	60	839	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
P77989	3.24e-38	208	973	26	741	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KPJ7	2.60e-36	211	807	76	678	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
T2KM09	5.42e-32	193	905	56	759	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000266	0.999101	0.000210	0.000148	0.000146	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001433_01620.