CAZyme Information: MGYG000001433_01670

Basic Information

• Species: Bacteroides salyersiae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides salyersiae
• CAZyme ID: MGYG000001433_01670
• CAZy Family: GT11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
273	MGYG000001433_1|CGC41	32509.95	9.0371

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001433	5309986	Isolate	not provided	not provided

• Gene Location: Start: 2153927; End: 2154748 Strand: -

Full Sequence      

MIFVKGYGQMCNNILQYAHAYVWGKENNVKVVSMRFAYKYRYFEVCNYKYHRWPVYLFAK
MLIKLQLIKCFFLDEPTDVTPDVLAELKRHRMVAIDGWQFRFPELFMKYRTEIKDMFAFK
SLVLNKIKSFLEEHTKADGTDVRLAVHIRRGDYKVWMGGKYFFNDDVYIEHIRQFLDNFP
DKKVSVFICTNDRNLNVNCYREALGLKSIYCPKGNEAEDLCLLSQCDYIIGVKSTFSLMA
AFYNNRPIYWIMDKNAPLQLSNFSSFEKLFMTV

Enzyme Prediction     

No EC number prediction in MGYG000001433_01670.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	1	256	8e-24	0.9202898550724637

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	1.64e-12	1	264	1	265	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	1.37e-09	109	257	129	279	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.
cd11548	NodZ_like	4.99e-07	43	248	64	285	Alpha 1,6-fucosyltransferase similar to Bradyrhizobium NodZ. Bradyrhizobium NodZ is an alpha 1,6-fucosyltransferase involved in the biosynthesis of the nodulation factor, a lipo-chitooligosaccharide formed by three-to-six beta-1,4-linked N-acetyl-d-glucosamine (GlcNAc) residues and a fatty acid acyl group attached to the nitrogen atom at the non-reducing end. NodZ transfers L-fucose from the GDP-beta-L-fucose donor to the reducing residue of the chitin oligosaccharide backbone, before the attachment of a fatty acid group. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
cd11296	O-FucT_like	6.71e-05	109	243	41	200	GDP-fucose protein O-fucosyltransferase and related proteins. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT74140.1	1.31e-205	1	273	1	273
QUB65418.1	6.89e-86	1	273	1	270
QUB68171.1	3.94e-85	1	273	1	270
QUB58627.1	5.58e-85	1	273	1	270
QUB56031.1	5.58e-85	1	273	1	270

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999975	0.000029	0.000008	0.000000	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001433_01670.