CAZyme Information: MGYG000001433_01848

Basic Information

• Species: Bacteroides salyersiae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides salyersiae
• CAZyme ID: MGYG000001433_01848
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367		42348.66	7.3674

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001433	5309986	Isolate	not provided	not provided

• Gene Location: Start: 2387598; End: 2388701 Strand: -

Full Sequence      

MNRFFLSIVSLLVSLSMSGQLPFQKSEVKEVMKKVADWQIAHQKDVKHGPLDWTNAALYM
GMLDWAELAEKESGDTSYYDWLVKLGRRYGWQPDKRMYHADDIAVGQVFVDLYCKYKDRN
MLYPTQARAEWVVNHPSDGPMELDYKKRETLERWTWCDALYMAPPVYVKLYVLTGDKRFI
KFMNKEYKATYDLLFDKDERLFYRDSRYLTQKEANGAKVFWGRGNGWVLGGLAEMLQDFP
KKDKNRKFYEDLFVTLSERAAKLQSLDGFWHASMLDPASYPSPETSATGFIVYALAYGIN
EGLLDKDIYLPVVEKGWKALVSAVETDGKLGYVQPIGADPKKVTRDMTEVYGVGAFLLAG
NQIYKLI

Enzyme Prediction     

No EC number prediction in MGYG000001433_01848.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	49	364	6e-84	0.963855421686747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.44e-100	31	366	1	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	4.12e-49	52	359	35	349	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT74307.1	3.53e-280	1	367	1	367
ASM65072.1	1.68e-199	11	366	13	370
QUU06865.1	1.68e-199	11	366	13	370
QRP56352.1	1.68e-199	11	366	13	370
QQT78403.1	1.68e-199	11	366	13	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	1.45e-84	23	366	24	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	3.30e-63	26	362	31	370	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	3.30e-52	27	362	15	353	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
1NC5_A	5.07e-12	101	366	88	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.08e-11	101	366	78	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	9.77e-84	23	366	31	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	3.89e-83	13	366	19	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	2.07e-66	21	363	48	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	2.77e-11	101	366	88	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.015987	0.979439	0.003751	0.000256	0.000269	0.000274

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001433_01848.