CAZyme Information: MGYG000001433_01969

Basic Information

• Species: Bacteroides salyersiae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides salyersiae
• CAZyme ID: MGYG000001433_01969
• CAZy Family: GH85
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1253	MGYG000001433_1|CGC50	138486.33	4.7745

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001433	5309986	Isolate	not provided	not provided

• Gene Location: Start: 2578794; End: 2582555 Strand: -

Full Sequence      

MKRNLLLLSGIAVLSLSANAQELKEDYMVWPNSGGLPGYVTEWTPGTPLFEDENFYISRV
KPKERFRNAATQINETLNEANDKKLVFWVPVGNAAGGSPNARPNGVFDGEVFSTWSYVTH
YGDWTSPHGWVPGGFADVAHKNGVGVSGVASIPNASINANDGAWGQALHEQVALDNEKLA
KFLHYHGVDGLGYNAEFYGMSADLPALRTQHEFIHKYLVEQGNNLAENFWYDGTNDNGGI
SFDGGIGSHNKETFGNGEHIRTSLFFNYNWHRSNVLNSLSNLQNVAPGRNPLDIYAGFNM
QGGDPSTWTTLADYPMSIGLWGAHERNMLWAGRAKQGSSDIAKQTTYQNVLEMFFTNGNR
NPAKSIDIYNAGSHFPDEKWFGMSAYMSARSSLSWDLSEEPFITFFNLGNGRFFNWKGKR
QNNNEWYNIGVQDYLPTWRYWFASSFMGKKATDVLPNGLDAQFTWDDAYVGGSCLRIFGT
TADEYLHLFKTDFALKTNDVITVRYKLVKGKSDINLILSAKGNETVILRESNLKVVTTSE
VADDEVWIEKTFKVSGLLTTLSNKEIAMIGLHFMNTQDLDLYLGEFSITRGTTSTPSAPE
ITVAKTLGNHYKGVDAKVIFNMPNNKEAGTPVYNLDVNASMFKLYAQQEGGDPIFMGITT
SWAGMYYSIPVDADKAQRIRLGVAAVSVDTNSDSDIKWSNYIDGFGDYFTINDVQIDKTT
IKPEEDFEISYVDPRHNPAGWKLYNAEGEVVKEANNTVKFSVTEGIKEVGAYDLEITESD
TTRRFNSYVQITSWGSGALPQIKTLTIDGETVQEGASPIKIEIGKELTLGYTGREADGAA
SRGVEIDEGWVGGKVAPLDIASYKSFSVSTWVLFNSLPGSTAFFSIENRASTWPVNNWGW
FWSNVDSKGKLDSYTFRSATAGGSDELKYTFPETVIVPNSWNHVALVFEYNENGQFRSKF
YVNGTLQKSTWIFGRTSGTTEDWCSIRFALPSDYWFGFGGGRGEGATFNNGIIDELQIWD
GAMTEADVQTSKAGLDANNLPANILAYWDFDTDANDSHYFTAKGTKTEAQACAFKIVAGV
NEGSGTQTPQQPLYISGTPFIAGSAYKIETLPTWTAKRAVISEATGNATAGSAKLSYAKP
DDRTVTLTLANTLGSDSKEYPVFTIYDPVGIEDTNVTGELRTYTVEDILFVEFAEDGNYQ
VSVYTVSGMLAAQKTETLYAGQNMRITLGTNGIYLVKVIKDGKEVRTIKVLKK

Enzyme Prediction     

No EC number prediction in MGYG000001433_01969.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH85	103	414	6.9e-43	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4724	COG4724	3.04e-41	36	589	35	550	Endo-beta-N-acetylglucosaminidase D [Carbohydrate transport and metabolism].
cd06547	GH85_ENGase	4.34e-28	102	441	17	334	Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins. The beta-1,4-glycosyl bond located between two N-acetylglucosamine residues is hydrolyzed such that N-acetylglucosamine 1 remains with the protein and N-acetylglucosamine 2 forms the reducing end of the released glycan. ENGase is a key enzyme in the processing of free oligosaccharides in the cytosol of eukaryotes. Oligosaccharides formed in the lumen of the endoplasmic reticulum are transported into the cytosol where they are catabolized by cytosolic ENGases and other enzymes, possibly to maximize the reutilization of the component sugars. ENGases have an eight-stranded alpha/beta barrel topology and are classified as a family 85 glycosyl hydrolase (GH85) domain. The GH85 ENGases are sequence-similar to the family 18 glycosyl hydrolases, also known as GH18 chitinases. An ENGase-like protein is also found in bacteria and is included in this alignment model.
pfam03644	Glyco_hydro_85	3.78e-19	107	411	5	291	Glycosyl hydrolase family 85. Family of endo-beta-N-acetylglucosaminidases. These enzymes work on a broad spectrum of substrates.
pfam13385	Laminin_G_3	4.34e-12	864	1029	17	151	Concanavalin A-like lectin/glucanases superfamily. This domain belongs to the Concanavalin A-like lectin/glucanases superfamily.
TIGR04183	Por_Secre_tail	5.55e-05	1184	1253	6	72	Por secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber average twenty or more copies of a C-terminal domain, represented by this model, associated with sorting to the outer membrane and covalent modification.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT74450.1	0.0	1	1253	1	1253
AHF11930.1	0.0	1	1251	1	1251
QFQ13703.1	0.0	6	1253	6	1247
EFC71164.1	0.0	2	1253	4	1247
QUB60779.1	0.0	1	1249	1	1246

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VTF_A	1.47e-30	32	687	13	608	X-raycrystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae],2VTF_B X-ray crystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae]
3FHA_A	4.42e-30	32	524	8	468	ChainA, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_C Chain C, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]
3FHQ_A	5.88e-30	32	524	8	468	ChainA, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_F Chain F, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000322	0.998983	0.000209	0.000174	0.000165	0.000147

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001433_01969.