CAZyme Information: MGYG000001433_02053

Basic Information

• Species: Bacteroides salyersiae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides salyersiae
• CAZyme ID: MGYG000001433_02053
• CAZy Family: GH63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
642	MGYG000001433_1|CGC52	73513.89	4.9794

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001433	5309986	Isolate	not provided	not provided

• Gene Location: Start: 2722215; End: 2724143 Strand: +

Full Sequence      

MKKLIMRICGLVGAVMFFINCSERKPVAYNSLVHEYGNILDIAYTPNDSAFGRGWFSDQG
SWMGFTLPEKEQWINGFCGPFDLESRRWISKSLLTVGLTEYPDAVFHADSVNYFPGELFM
RSSMEKGVITQRLIFIDRSNVLLECVLEDEQSLCFSGRISERSTCNVVNNSCVLSLSSGQ
QCMLTFPDRTKITLSNDGYEARTAPERTVYVIMSFLDNPQIRSFDFGAIGDMEAHPAGYI
EKHYQRWNGYLGKVLRSDMPEEYNRIAVKAVVTLISNWRSSRAGLLHEGVVPSHAVGYFM
GFWAWDSWKHAAALADFAPELAKNQIRAMFDYQLDNGMIIDCIYTDIRENNARDSKPPLA
AWAVDRVFEETGDTSFVKEMYPQLLNYYRWWYIDRDHNSNGICEFGSVDGTLEAAAWESG
MDNAIRFDDARMVKNSDTAWSFDQESVDLNAFLAYEYKLLKKLANVSGQAFDEKDRTDSI
RTYFYDEDAGFFFDRRMDGTFVKVAGSEAYIPLWTGIATEAQTSDVMRQLEDTTKFSTYI
PFPTVAADNPDFMPKGYWRGPIWLDQTYFAISGLRKYGYVKEADKYTRQVFDRLNGLKGN
GAIHENYEAHTGERLKAPHFSWSAAHLLMLYEEYGQRGKERM

Enzyme Prediction     

No EC number prediction in MGYG000001433_02053.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	191	634	6.3e-106	0.5614035087719298

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	4.61e-125	1	634	1	783	alpha-glucosidase; Provisional
COG3408	GDB1	1.30e-21	261	631	245	603	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam01204	Trehalase	3.67e-15	355	635	178	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
PLN02567	PLN02567	3.68e-09	350	635	193	545	alpha,alpha-trehalase
COG1626	TreA	9.81e-07	415	588	324	497	Neutral trehalase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM58118.1	7.27e-260	34	636	33	642
QUT89313.1	3.27e-258	34	636	33	642
QJR62245.1	3.51e-258	22	636	26	644
QJR74523.1	3.51e-258	22	636	26	644
QJR66502.1	3.51e-258	22	636	26	644

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	4.11e-76	176	634	188	756	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	2.12e-75	176	634	188	756	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	2.94e-75	176	634	188	756	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	1.08e-72	176	634	189	757	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
7PQQ_B	8.82e-38	176	408	514	769	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	3.36e-75	176	634	211	779	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	1.33e-23	288	625	83	479	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	3.19e-23	288	625	83	479	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
P94250	3.86e-10	326	607	92	353	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2
K5BDL0	4.46e-09	289	628	26	442	Glucosylglycerate hydrolase OS=Mycolicibacterium hassiacum (strain DSM 44199 / CIP 105218 / JCM 12690 / 3849) OX=1122247 GN=ggh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000037	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001433_02053.