CAZyme Information: MGYG000001433_02087

Basic Information

• Species: Bacteroides salyersiae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides salyersiae
• CAZyme ID: MGYG000001433_02087
• CAZy Family: GH85
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1010	MGYG000001433_1|CGC54	112149.85	4.5266

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001433	5309986	Isolate	not provided	not provided

• Gene Location: Start: 2780319; End: 2783351 Strand: -

Full Sequence      

MKKFTLFSMAAMLLLSGQAPAQDKTDYPPSASTEVFDFTPWKESTILELFVKAMNEGRNY
PSAEEWTEAGFNLDLEFSRSHVRPRDIIEDASKNVVPEVYAKRRLWMNMPTGQGDLVGGY
PSSLFNNDTFSMWNYVNLYGAWNHSPFQAPGSWADAAHKNGTDMFSGIKFFDTTGGRGQT
ATEYINLISTKNPDGSFRYVDAFINVLKFFGLDGINYNWEDTGYNNETVIAFHQALYKRA
AELNFDSFHIGLYGGPSYLTNPADYFANENGRTTEVMMNYSANDIPRTLAMSQKNAIAIQ
GDCEGLYQGVWIASMDRQWTNFHADGAEQVGLCLWGEHKISRFFQFAIGDNTMELQSNYQ
KLLEKGFSGGKRSPIDRPALSNSGNIFEISNNDDKPNQMVNFAGFADFVPERTAIQGDLP
FTTHFSLGNGERYNYKGKKTFGSWYNMGQQDIVPTYRWLIYDANTKTRSTAVDAEFTHED
AYTGGSALRLSGEPTAKGSDVVLYRAKLNVSGGNAKANVALKSGVNGTNASNLYVILKKF
NDDTWMEFPVGNLNGPTWEEKEIALSGINSGDIIEYIGFRVKGTYEGNYNMLIGKLALTD
DCAVKTPAPIDAESIIVEVKEETTQSLSVKLNWAVNATGYNSDNAKYGLIYNDEVNIDHF
QLMYKNGENGKVSEIGRTSTWSAYLGNIMFETATDDPYIGIRSVSVDGKTYSPVEWIHIG
RGNASELPAFNNDPYCESTLNYNAEGADIAIEVRYIEQFKTTGAVEDINYTADAPQADGT
QYAMCDQTLKVNQGQEVELFFKAADLDDGLKFCLGKAYIDLDGSKSHEPATETIFELGTV
KQGTPEFQTTGVTQKFTIPADAKPGESRLRLVFSDAWFAHPGPCGFTAKGFTLDIPVEII
GNNPSREPAPDMHDQGEADEPEGLNNNPDGVENVWKDSESVISTMWPTTTEGTIYFNNVE
KAWIYTTDGQLVKYVPNNPSSTDISDITPAIYVVKMQKGNIVRSQKLIKK

Enzyme Prediction     

No EC number prediction in MGYG000001433_02087.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH85	125	433	1.8e-38	0.9428571428571428

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4724	COG4724	5.05e-28	65	601	41	552	Endo-beta-N-acetylglucosaminidase D [Carbohydrate transport and metabolism].
cd06547	GH85_ENGase	5.62e-27	115	464	5	339	Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins. The beta-1,4-glycosyl bond located between two N-acetylglucosamine residues is hydrolyzed such that N-acetylglucosamine 1 remains with the protein and N-acetylglucosamine 2 forms the reducing end of the released glycan. ENGase is a key enzyme in the processing of free oligosaccharides in the cytosol of eukaryotes. Oligosaccharides formed in the lumen of the endoplasmic reticulum are transported into the cytosol where they are catabolized by cytosolic ENGases and other enzymes, possibly to maximize the reutilization of the component sugars. ENGases have an eight-stranded alpha/beta barrel topology and are classified as a family 85 glycosyl hydrolase (GH85) domain. The GH85 ENGases are sequence-similar to the family 18 glycosyl hydrolases, also known as GH18 chitinases. An ENGase-like protein is also found in bacteria and is included in this alignment model.
pfam03644	Glyco_hydro_85	4.26e-11	129	430	9	291	Glycosyl hydrolase family 85. Family of endo-beta-N-acetylglucosaminidases. These enzymes work on a broad spectrum of substrates.
TIGR04183	Por_Secre_tail	2.45e-07	947	1010	5	72	Por secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber average twenty or more copies of a C-terminal domain, represented by this model, associated with sorting to the outer membrane and covalent modification.
pfam18962	Por_Secre_tail	7.79e-04	947	1008	5	71	Secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber have on average twenty or more copies of this C-terminal domain, associated with sorting to the outer membrane and covalent modification. This domain targets proteins to type IX secretion systems and is secreted then cleaved off by a C-terminal signal peptidease. Based on similarity to other families it is likely that this domain adopts an immunoglobulin like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT74553.1	0.0	1	1009	1	1019
BCI64641.1	0.0	1	1009	1	1006
AGB28382.1	0.0	20	1008	191	1188
EFC71166.1	7.84e-310	2	1008	3	1004
QFQ13761.1	5.38e-309	1	1007	1	989

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000432	0.936281	0.062567	0.000287	0.000228	0.000190

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001433_02087.