CAZyme Information: MGYG000001433_02126

Basic Information

• Species: Bacteroides salyersiae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides salyersiae
• CAZyme ID: MGYG000001433_02126
• CAZy Family: GH88
• CAZyme Description: Unsaturated chondroitin disaccharide hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
398	MGYG000001433_1|CGC55	45766.31	8.1316

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001433	5309986	Isolate	not provided	not provided

• Gene Location: Start: 2839539; End: 2840735 Strand: +

Full Sequence      

MKYLFRIVCAVCLFAGCSNGGKDGMDDLVDRSLERAIVQSKLMASDLISKPGLLPRTIDK
EGKLETSTSRWWCSGFFPGVLWYLYEVSSDDSLKNYAQEFTKRIEREQYTTTNHDVGFML
YCSFGNGLRLTKDESYKKVLLQGSKSLSTRYRPMVGCIRSWDWNKKVWQYPVIIDNMMNL
EMLMWASKNSDNPEFSKIARSHADVTMKNHFRSDYSCYHVVSYDTITGLPEKKNTCQGYS
HESSWARGQAWALYGYTMMYRETKDLRYLEQATNIAKFIINHPNLPTDKVPYWDFDAPDI
PNTLRDASAAAIMASAFIELSVYAETNIAKLCLETAKIQIKTLSSPEYLSEPNTNCNFIL
KHSVGNYPGKGEIDVPLTYADYYYVEALVRYKKYVLKK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	66	391	8.8e-130	0.9908814589665653

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.65e-10	70	304	26	252	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAO78019.1	7.14e-221	1	398	1	399
QMW85341.1	7.14e-221	1	398	1	399
QQA08876.1	7.14e-221	1	398	1	399
QQT78513.1	1.67e-219	1	398	1	399
QRP59602.1	1.67e-219	1	398	1	399

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	3.45e-126	1	391	1	388	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	8.91e-46	29	393	28	391	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	9.10e-46	29	393	29	392	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3WUX_A	2.48e-45	29	393	29	392	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]
3ANI_A	4.82e-45	29	393	29	392	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	1.66e-107	69	397	74	400	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q8E372	4.98e-45	29	393	29	392	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q8DR77	1.81e-44	29	393	27	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q9A0T3	2.70e-44	29	393	30	393	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q9RC92	8.88e-44	55	393	25	366	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000046	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001433_02126.