CAZyme Information: MGYG000001433_02167

Basic Information

• Species: Bacteroides salyersiae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides salyersiae
• CAZyme ID: MGYG000001433_02167
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
759		84598.49	6.3916

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001433	5309986	Isolate	not provided	not provided

• Gene Location: Start: 2898646; End: 2900925 Strand: +

Full Sequence      

MKTRKLLIALVLGMGTATAWAGETEERPLYKDSLAPIESRVEDLLRRMTLHEKTLQLQNK
PVGRIDEIESIFQGQSYGCTHEMGKTAEECAGIYNELQKYMLTKTRLGIPILTAVEGIQG
ILQNNSTLFPHSIAQGSTFNPELIERMTDAAGKEAAAMGIHQVLSPVFDIARELRWGRVE
ETYGEDPFLISEMGIGFVKGYQKHQITCTPKHFVAHGTPAGGLNCAFVSGGEREFRSIYL
YPFARVIKETNPLCIMSCYSAYDGIPVSASPYYMTDVLRDELGFKGYVYSDWGSVDRVMT
FHYAVPTREEAAKVSLIAGVDLDVDSDYETLEQQVKEGKIDEAYIDKAVRRVLYVKFALG
LFDRPYYGDPKLVKKVVRSDKHIALAKEVADESTILLENKNNILPLDLSKYKSIAVVGPN
SNQTVFGDYSWTTPDTKEGVTLYQGLQQVLGKKKTILQADGCNWWNRADSKDIEQAVKAV
EQSDLAIVAVGTRSTFLGRGPRYSTAGEGFDLSSLELPGNQSELLKAVKATGKPMIVVLI
SGKPLVMSWAKENADAVLVQWYAGEQQGRSLADILVGNVNPSGRVNVSFPRSTGNTPCFY
NYYPTDRVQRFDRPGTYEEPAGHYIFEHPYALWEFGYGLSYTNFNYSGCTLNDSIYSDQS
TIVATVEVENTGKRDGKEVVQLYVRDKISSVSTPIKQLKAFKKVFIKAGEKKKVTLEVPM
SELALYDVRMKPVVEPGEFEIQIGSSSDRIHFNKTILVK

Enzyme Prediction     

No EC number prediction in MGYG000001433_02167.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	104	323	9.3e-66	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.82e-176	1	751	1	758	beta-glucosidase BglX.
COG1472	BglX	1.22e-89	48	463	1	396	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	7.88e-80	36	752	48	774	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	1.46e-70	104	353	61	314	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	1.20e-67	394	641	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQA08973.1	0.0	1	759	1	757
QMW85286.1	0.0	1	759	1	757
AAO77960.1	0.0	1	759	1	757
ALK83130.1	0.0	16	758	18	756
ABR38447.1	0.0	16	759	18	757

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	2.83e-170	25	759	2	757	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	2.24e-169	25	759	2	757	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	3.28e-127	3	758	4	785	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
6R5I_A	4.36e-123	38	747	4	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	2.38e-122	38	747	4	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	9.35e-139	106	747	62	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
Q56078	9.46e-124	41	750	38	757	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	4.87e-119	41	750	38	757	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH9	1.50e-118	4	755	2	750	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	4.46e-97	1	744	1	762	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000398	0.998785	0.000271	0.000178	0.000186	0.000166

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001433_02167.