CAZyme Information: MGYG000001433_02878

Basic Information

• Species: Bacteroides salyersiae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides salyersiae
• CAZyme ID: MGYG000001433_02878
• CAZy Family: GH66
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1074	MGYG000001433_2|CGC9	119181.7	4.6011

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001433	5309986	Isolate	not provided	not provided

• Gene Location: Start: 654597; End: 657821 Strand: +

Full Sequence      

MKKKMKRNMKKNMKKKILLSVVSFSLAVGAGAHDDLIYRTQAGWNFDIGNQSVISQTLDA
VFTGGACVGDYDGDGRVDICEVETTGEMIKWVWKINNGKKDWITSTPVGFGISATDKYVT
GDFNGDGKTDIAVMRSGAGGLATWYIDFSPCEGNIDARGQFGLPGDIPLSGDFNGDGIDD
LAVYRPSTSTWYVAFSSLTGYPEFDMPLAINGVVFGTAEDVPFTGDFNGDGYTDMALYRA
STGQILINYWSADKPQYEHYADSNGYGTVDCTVTVPLTGVLAVMSADADQSRPAVLPLAT
LEETGKEVNLRHGWTCIFDNSLDVDKWARNLEAAGINTLEYHPWMRAHEEVAPQTETWNT
YVGDDRLWTSKAMMKKKIEKFRSIGGRSVCYTGIYAATPAFAHTCPDWAMRNAGDRSFIT
YGGSYLYLMSTNESVDAPYTIGGETYKNFNDYFVHQAVTAQKEYNWDGYRWDWYGLPDSY
VCDGTEAACNFSSEMAPLVKRLDLAVKEQRADVTTTALQLPSTNGNIPHYTTGAVANHQF
MELWPFGTGTKYTDLYRDIYEAKSRYPDKPVFANFYPPAEMNLTTGWPKQNIDYQFATCL
SAGGYPAAQVVDGVASFTDPVPFHAVNYPLEVLEQIARWNKFTEAYGAYLYYSNRAYVIA
DYNQSDLVLDNADGIYAKLKRRWDKRTGRADALIVDLVNYGSSVDLRWDVVNTAPAAKAT
GLSFTLPEDAVPADLYCVTLEGSRKVDYTREGDKVKVSLSSLGTFATLVLHLNSTVGMPE
APAEKSVAFDLFPFRYDAGGETLRSEETAAITILDDQEPLIVSNDYNGNVSQIQTVTDAF
AGEKALQVTPGMIRFTTTSDGAIRVPLDRFNRFKIAVRSHNTTACWFGFRLIKPSDSSPV
WETKDLFYRVGYSQPGLAYLTLTPVKPKVDEWVEYERDLREDITGLWGEDWADAIVVSVF
MGPVDRNSADYDNLIFMSDKYTGIESSKKKEEISVCFDDGGSRMIISGGTGQERLCEIRL
ADMGGRICYEDRLRFGNGVLSCSIPPLSQGAYLLTISDVEQEGYHRLYASVVLR

Enzyme Prediction     

No EC number prediction in MGYG000001433_02878.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH66	323	712	8.5e-16	0.6618705035971223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13517	VCBS	8.41e-07	70	133	1	61	Repeat domain in Vibrio, Colwellia, Bradyrhizobium and Shewanella. This domain of about 100 residues is found in multiple (up to 35) copies in long proteins from several species of Vibrio, Colwellia, Bradyrhizobium, and Shewanella (hence the name VCBS) and in smaller copy numbers in proteins from several other bacteria. The large protein size and repeat copy numbers, species distribution, and suggested activities of several member proteins suggests a role for this domain in adhesion (TIGR).
pfam13517	VCBS	3.61e-05	122	183	1	61	Repeat domain in Vibrio, Colwellia, Bradyrhizobium and Shewanella. This domain of about 100 residues is found in multiple (up to 35) copies in long proteins from several species of Vibrio, Colwellia, Bradyrhizobium, and Shewanella (hence the name VCBS) and in smaller copy numbers in proteins from several other bacteria. The large protein size and repeat copy numbers, species distribution, and suggested activities of several member proteins suggests a role for this domain in adhesion (TIGR).
cd14745	GH66	4.69e-05	336	582	31	260	Glycoside Hydrolase Family 66. Glycoside Hydrolase Family 66 contains proteins characterized as cycloisomaltooligosaccharide glucanotransferase (CITase) and dextranases from a variety of bacteria. CITase cyclizes part of a (1-6)-alpha-D-glucan (dextrans) chain by formation of a (1-6)-alpha-D-glucosidic bond. Dextranases catalyze the endohydrolysis of (1-6)-alpha-D-glucosidic linkages in dextran. Some members contain Carbohydrate Binding Module 35 (CBM35) domains, either C-terminal or inserted in the domain or both.
pfam13517	VCBS	3.29e-04	172	237	1	61	Repeat domain in Vibrio, Colwellia, Bradyrhizobium and Shewanella. This domain of about 100 residues is found in multiple (up to 35) copies in long proteins from several species of Vibrio, Colwellia, Bradyrhizobium, and Shewanella (hence the name VCBS) and in smaller copy numbers in proteins from several other bacteria. The large protein size and repeat copy numbers, species distribution, and suggested activities of several member proteins suggests a role for this domain in adhesion (TIGR).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT75822.1	0.0	1	1074	1	1070
ATF70697.1	3.87e-10	310	584	87	339
QNE18683.1	1.92e-07	49	154	637	751
BCX42219.1	1.40e-06	69	237	485	664

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000323	0.999016	0.000178	0.000167	0.000147	0.000142

TMHMM  Annotations     

start	end
17	34