CAZyme Information: MGYG000001433_02880

Basic Information

• Species: Bacteroides salyersiae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides salyersiae
• CAZyme ID: MGYG000001433_02880
• CAZy Family: CBM35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
887	MGYG000001433_2|CGC9	100274.86	4.8047

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001433	5309986	Isolate	not provided	not provided

• Gene Location: Start: 659056; End: 661719 Strand: +

Full Sequence      

MKLYLYCSLFALLFLVSCRSDKVYSEWSLQNRESGEYLGEKQGSFCFAAEPSGDEYLWII
ESTSGEEFLIKNKKSGNYLQLDGEGAVCAAPGGQETENMKWKYGGFDFVTQKNCGWYTLE
NGAAETERHLARRADGIVMDDSDRVKDYRSHWNIVRETGTELSFVLTPDKVTDASFLGTR
EAVAVSDTEIESDYHGKDRWKLQKDISAFPRFTAENNRLLAALYNMALEEMLLDIRTDST
FMAGALWPDTWTRDAVYSIYFSYAWILPEVSRKTLEKQTLQNPKEALQDTGSGGSWPIST
DRVVWAMAAWEYYLYTGDKSWLESVYDGLKYTAQKDIHVAFDANAGLFKGETCSMDWRTH
TYPNWFINSVIADSFSSGTNALHKFLYQFLGAAGRITGKPAEEIAVWDQYADLLKENINK
RFWDEKQGCYTCYLYPEYLGYRPAQRVGVMSNGLAAVLGIATPEQSAKMVENFPVYPYGA
AVLYPSIPDDFSYHNKSVWPVWETPYMYAARDAKNVQVVEHMMKSLMRAGALFLTHKENM
TYDTGYDRGTALNSSRQLWSVASYISMVYRVLFGMTMSEEGITFTPVIPDLVDGKISLEN
FRYRDAVLNLNVTGKGNTVKRLLVNGEEQSLPYLFPATAQGDYTIDIVMTTVPAGEKMNL
VQPGPRKDWSPVEPVLIQEGQVINCSVEPGLRYFLCSREREDKEITFPYDLSREPAGFYS
VYSMDSRGFKSDCSNPVIKTDWRKVFEAEDAVSKGTFSQAHSGYSGRGFIVDLYAKPADV
TFTVDVPVDGDYALVLSGANGHGPDGTYCTIRSVFIDNVDAGTFILEATGDWNKWMRSNY
LWKNMKAGRHTVSLRLNPEGKGFDSNMSHGREDANDCNLDYLEVIRM

Enzyme Prediction     

No EC number prediction in MGYG000001433_02880.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM35	746	856	1.1e-17	0.8907563025210085

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04083	CBM35_Lmo2446-like	8.24e-21	746	884	3	125	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
COG3408	GDB1	7.95e-18	216	611	248	641	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
cd04082	CBM35_pectate_lyase-like	1.77e-14	745	884	2	124	Carbohydrate Binding Module family 35 (CBM35), pectate lyase-like; appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. This family includes carbohydrate binding module family 35 (CBM35) domains that are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. Included in this family are CBM35s of pectate lyases, including pectate lyase 10A from Cellvibrio japonicas, these enzymes release delta-4,5-anhydrogalaturonic acid (delta4,5-GalA) from pectin, thus identifying a signature molecule for plant cell wall degradation. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. Some CBM35s bind their ligands in a calcium-dependent manner, especially those binding uronic acids.
cd02795	CBM6-CBM35-CBM36_like	1.32e-09	747	884	3	124	Carbohydrate Binding Module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules. This alignment model also contains the C-terminal domains of bacterial insecticidal toxins, where they may be involved in determining insect specificity through carbohydrate binding functionality.
cd04086	CBM35_mannanase-like	3.55e-09	744	854	1	104	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT75824.1	0.0	1	887	1	887
QEC45824.1	0.0	16	885	13	885
AFG37033.1	4.80e-152	164	887	51	782
AHM62083.1	4.61e-136	199	887	222	900
QEN03989.1	2.46e-135	153	854	31	744

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X7O_A	5.39e-09	745	884	835	965	Crystalstructure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase [Paenibacillus sp. 598K],5X7O_B Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase [Paenibacillus sp. 598K],5X7P_A Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase complexed with acarbose [Paenibacillus sp. 598K],5X7P_B Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase complexed with acarbose [Paenibacillus sp. 598K],5X7Q_A Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase complexed with maltohexaose [Paenibacillus sp. 598K],5X7Q_B Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase complexed with maltohexaose [Paenibacillus sp. 598K],5X7R_A Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase complexed with isomaltohexaose [Paenibacillus sp. 598K],5X7R_B Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase complexed with isomaltohexaose [Paenibacillus sp. 598K],5X7S_A Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase, terbium derivative [Paenibacillus sp. 598K],5X7S_B Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase, terbium derivative [Paenibacillus sp. 598K]
5X7G_A	5.79e-09	746	854	405	510	CrystalStructure of Paenibacillus sp. 598K cycloisomaltooligosaccharide glucanotransferase [Paenibacillus sp. 598K],5X7H_A Crystal Structure of Paenibacillus sp. 598K cycloisomaltooligosaccharide glucanotransferase complexed with cycloisomaltoheptaose [Paenibacillus sp. 598K]
3WNL_A	1.37e-06	746	855	387	493	ChainA, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNM_A Chain A, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNN_A Chain A, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNN_B Chain B, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNO_A Chain A, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNO_B Chain B, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans]
3WNK_A	1.38e-06	746	855	406	512	ChainA, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P70873	1.40e-07	746	862	415	528	Cycloisomaltooligosaccharide glucanotransferase OS=Niallia circulans OX=1397 GN=cit PE=3 SV=1
P94286	8.34e-06	746	855	423	529	Cycloisomaltooligosaccharide glucanotransferase OS=Niallia circulans OX=1397 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000026	0.018732	0.981273	0.000006	0.000008	0.000007

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001433_02880.