CAZyme Information: MGYG000001433_03657

Basic Information

• Species: Bacteroides salyersiae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides salyersiae
• CAZyme ID: MGYG000001433_03657
• CAZy Family: PL32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346	MGYG000001433_2|CGC22	38650.78	4.5803

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001433	5309986	Isolate	not provided	not provided

• Gene Location: Start: 1526490; End: 1527530 Strand: -

Full Sequence      

MKTKLSFLIVAISVCMSALAVEVPAKLFVRGTALAESSVAMEMKRINEDFPKFYMGEGSI
SNTYELFTALKTGSYEFATSADGGALIQAATITVDGGESLVPYRIRVNFDEATPVVSVLK
VDEVILWAPSKKYVITNLEYVGNSTFYNDYVEYIKADWGDERYRIRVYTEDGEYTTYGYK
LRAVSAPDNDSNEDEKLPGYFDLYTTTNIEGWDETIDGEKFYGSEYKLSVKRRTANPLLP
FSVKVIFSTSKNYTHELRDYDPTSIRENKMQNVNIYPTIIDNSTTVSVAEGAFSVEFVSI
TGVSVLKVNSSGNVLNLEGLDMASGMYLVKIVQDNNVLSVKRVIKL

Enzyme Prediction     

No EC number prediction in MGYG000001433_03657.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL32	21	346	3.8e-175	0.5258064516129032

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18962	Por_Secre_tail	4.36e-04	275	344	1	72	Secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber have on average twenty or more copies of this C-terminal domain, associated with sorting to the outer membrane and covalent modification. This domain targets proteins to type IX secretion systems and is secreted then cleaved off by a C-terminal signal peptidease. Based on similarity to other families it is likely that this domain adopts an immunoglobulin like fold.
TIGR04183	Por_Secre_tail	0.001	275	345	1	71	Por secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber average twenty or more copies of a C-terminal domain, represented by this model, associated with sorting to the outer membrane and covalent modification.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EIY62148.1	8.84e-243	1	346	1	346
CUN08171.1	1.33e-81	24	345	297	619
CCY52439.1	1.33e-81	24	345	297	619
EIY62149.1	1.33e-81	24	345	297	619

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000310	0.998969	0.000175	0.000188	0.000173	0.000159

TMHMM  Annotations     

start	end
5	24