CAZyme Information: MGYG000001433_03659

Basic Information

• Species: Bacteroides salyersiae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides salyersiae
• CAZyme ID: MGYG000001433_03659
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	MGYG000001433_2|CGC22	43827.82	8.3456

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001433	5309986	Isolate	not provided	not provided

• Gene Location: Start: 1529398; End: 1530522 Strand: -

Full Sequence      

MKKYIIIIISLFLGFLNVSVFATNEKIPYTKVEIKLLMKKVADWQIKHQREVRHHPLDWT
NATLYIGMAKWAELADKVDKDEKYYKWLVNVGNRYLWKANKRMYHADDLAVCQMFIDVYN
RYKDKSMLKPTIERIDWIIDHPSKGSLIIDYANQTTLERWSWCDALFMAPPIFTRLYKET
GNEKYLQFMDKEYKASTIFLYDLEEKMFFRDSRYFYQREANGKKVFWGRGNGWVLGGLTE
MLKDLPKKNSYRNFYEELFVEMCGRMVEIQQPDGFWHASLLDPETYAAPETSCTNFIIYA
LAYGINEGLLDKATYLPTLLKSWKAVLGTIDSEGKLGYVQPIGADPKKVTKDMTEVYGVG
AFLMAGTELYKMAE

Enzyme Prediction     

No EC number prediction in MGYG000001433_03659.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	55	371	2.2e-81	0.9668674698795181

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	4.14e-97	38	372	2	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	4.85e-49	58	373	35	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT74307.1	2.11e-177	1	372	1	366
QIU93494.1	1.95e-174	25	374	22	372
QGT72377.1	3.66e-174	1	374	1	370
QIU93222.1	1.05e-173	1	373	1	369
ASM65072.1	4.56e-173	25	373	22	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	2.57e-84	24	372	19	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	3.14e-58	23	374	23	376	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	5.46e-47	44	368	27	353	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
1NC5_A	1.18e-13	81	369	59	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	4.88e-13	81	369	49	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	1.74e-83	24	372	26	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	4.36e-81	33	374	33	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	1.29e-66	24	369	45	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	6.49e-13	81	369	59	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000590	0.998468	0.000256	0.000217	0.000214	0.000206

TMHMM  Annotations     

start	end
5	22