CAZyme Information: MGYG000001433_03979

Basic Information

• Species: Bacteroides salyersiae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides salyersiae
• CAZyme ID: MGYG000001433_03979
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
920	MGYG000001433_4|CGC1	104843.73	6.4711

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001433	5309986	Isolate	not provided	not provided

• Gene Location: Start: 33450; End: 36212 Strand: -

Full Sequence      

MISRCKTILLTMFLLTSPYLLTAYGVKEGKKNIEPVGLQCEYLHNPSGLDIPHPRLSWKM
GTTVAVRGQRQTAYQVLVASSRELLDKEQGDLWDSGQVHSDESVHIVYDGKTLITGQKCF
WKVRLADEQGNWTSWSEPAYWQMGLFADDWSAHWIGSAEMESQSVGGRPVDNKMFDPWFR
KTFTLTESLKEALIYVASIGYHELYVNGCKIGNAVLAPSVTDHKSRARYVTYDISHYLKK
GENVIALWLGTSWAVFPAYQRNDKPAIPMALAQAEITLTSGSKVRVITDGSWKTHASPNV
LMGYWDAHHFAGEFYDASLEINGWNEAGFDDSEWAEAKVYQPQIIVSADKAESNLLMDEI
KPVAVEEVSPGVYRVDMGINYAGWFEMPLVGQPGDSVVFRFSEREKDACSYGIHSIYKIG
PDGKGTFRNRFNYMTGRWVQITGLRSAPDLKQIRGWMIRPDFRRSSGFECDISLLNDLYR
TTLWTFENLSLGNYIVDCPHRERRGYGGDALATTRTGLDNYQLGAFYTKWMEDWRDVQGE
DGNVPYTAPTYIGGGGPSWSGFCITLPWEVYRQYGDVRILEESFSTIRRWLNFVETKSKD
DMLVRWGGKWSFLGDWLWPDAWPERSAMEKEGKSLGDTRETLFFNNCHWIYSLETAACIA
DVLGNETMAVAWRKRAEEVRRAVHKTFFNPDDNSYVNGYPAYLAIALMVDLPPEKLKAKV
WKRLEYEILVNRKGHFWGGITAGSFLFHTLLDNQRNDLICEMATKEDFPSWGNMIKNGNG
TFFEDWECRGSALHSSYLYIGSWFVESLGGIQRPKSGFKEFVIAPWIDEKGPRQVRSHYN
SMYGTIVSNWKVTDDKLDIEVVVPANTTVLLKLPGVRFDSIKEGGSEWKKVKGIRLDSQR
DNTVVFSLQSGTYRFSARMN

Enzyme Prediction     

No EC number prediction in MGYG000001433_03979.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	366	872	2.3e-122	0.9940476190476191
CBM67	152	342	4.7e-37	0.9602272727272727

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	3.56e-67	463	808	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	4.21e-45	189	339	3	152	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	5.27e-15	810	885	1	75	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	2.00e-12	367	458	2	101	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
TIGR01577	oligosac_amyl	0.003	568	698	363	468	oligosaccharide amylase. The name of this type of amylase is based on the characterization of an glucoamylase family enzyme from Thermoactinomyces vulgaris. The T. vulgaris enzyme was expressed in E. coli and, like other glucoamylases, it releases beta-D-glucose from starch. However, unlike previously characterized glucoamylases, this T. vulgaris amylase hydrolyzes maltooligosaccharides (maltotetraose, maltose) more efficiently than starch (1), indicating this enzyme belongs to a class of glucoamylase-type enzymes with oligosaccharide-metabolizing activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT74996.1	0.0	1	920	1	920
ALJ60391.1	0.0	33	920	698	1585
QUT88602.1	0.0	33	920	696	1583
BCI64727.1	0.0	21	917	20	922
QDU88571.1	2.26e-304	25	915	786	1685

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.40e-112	35	915	32	939	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	2.37e-89	41	919	12	1032	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	2.02e-63	39	884	6	857	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3CIH_A	1.46e-06	467	825	303	653	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	2.07e-105	41	918	42	923	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
T2KPL4	6.15e-98	45	914	42	946	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
P9WF03	1.29e-88	31	911	27	918	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
Q82PP4	3.86e-88	41	916	12	1029	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KM26	5.05e-12	35	144	469	577	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.050120	0.903817	0.043990	0.001281	0.000396	0.000350

TMHMM  Annotations     

start	end
7	26