CAZyme Information: MGYG000001433_04083

Basic Information

• Species: Bacteroides salyersiae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides salyersiae
• CAZyme ID: MGYG000001433_04083
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
397		45466.23	4.9297

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001433	5309986	Isolate	not provided	not provided

• Gene Location: Start: 192826; End: 194019 Strand: -

Full Sequence      

MNLERFLLHSLCALALVGCAQKEQSNTNPNLLRAQETLDSLYQNYSQPDGNLLRENYPFD
QQNTVTYLASEEQANMPNQYSYLWPYSGTFSAVNALLEATGQSKYKELLDKKVLPGLEEY
FDTRREPQAYSSYIRTAPLSDRFYDDNVWLGIDFTDLYQMTKGAGYLEKARLIWNFVESG
TDDQLGGGIYWCEQKKESKNTCSNAPGAVLALKLFKATGDTLFLSRGRVLYEWTKTHLQD
STDYLYFDNIRLDGKIGRAKFAYNSGQMMQAAALLYQLTGIPAYLTDAQNIAKECYNYFF
VDFTPADGNTFKLIKRGDIWFTAVMLRGFIELYKQDNNKKYLDAFNRSLTYAWDNARDDN
GLFNVDLSGVDKDGKKWLLTQAAIVEMYARLAQIKDL

Enzyme Prediction     

EC	3.2.1.101

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	65	369	1.6e-68	0.8044692737430168

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03663	Glyco_hydro_76	1.58e-29	82	300	34	256	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG4833	COG4833	1.64e-12	139	266	87	212	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT74817.1	2.40e-300	1	397	1	397
QDH53715.1	2.61e-218	11	392	8	389
QUR45254.1	2.61e-218	11	392	8	389
ANU59352.1	3.71e-218	11	392	8	389
QQR15735.1	3.71e-218	11	392	8	389

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MU9_A	2.73e-105	28	391	2	362	Crystalstructure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482],4MU9_B Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4C1S_A	1.09e-68	83	395	45	371	Glycosidehydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],4C1S_B Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
6U4Z_A	4.68e-65	83	392	169	492	CrystalStructure of a family 76 glycoside hydrolase from a bovine Bacteroides thetaiotaomicron strain [Bacteroides thetaiotaomicron]
4V1S_A	7.73e-24	141	363	139	357	Structureof the GH76 alpha-mannanase BT2949 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],4V1S_B Structure of the GH76 alpha-mannanase BT2949 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
6SHD_A	8.63e-23	67	294	69	288	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O74556	3.99e-07	65	302	42	287	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000062	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001433_04083.