CAZyme Information: MGYG000001434_00253

Basic Information

• Species: Butyricicoccus pullicaecorum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Butyricicoccaceae; Butyricicoccus; Butyricicoccus pullicaecorum
• CAZyme ID: MGYG000001434_00253
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
508		54277.29	9.6646

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001434	3299523	Isolate	not provided	Europe

• Gene Location: Start: 237441; End: 238967 Strand: -

Full Sequence      

MSTNEERIWNYLIGKGLSKAGAAGLMGNLFAESGLSPKNLQNTYEKKLGFTDDSYTAAVD
SGSYQNFVRDSAGYGLAQWTFWSRKQNMLDFARAAGKSIGDLEMQLDFLFQELSGSYKQV
LSTLKTATTVRAASDSVLLNFERPADQSEAVKVKRAGYGQTYFDRYAAAAKPGNGGNLMG
NSPLVNYTKLSPNHSGKRTHAIDRITPHCVVGQCSVETLGNIFAPTSRQASCNYGIGPDG
RVLLCVDEGNRSWCTSSNANDQRAVTIECASDTTEPYAFKDVVYQKLIALCVDICKRNGK
KKLLWLGDKNKTLNYSPKSDEMVLTVHRWFANKSCPGNWMFARMGDLASKVTAQLGGSTV
QPSTPSAPASGLSVGTVVNFAGGKHYTSANAASGSAAKAGPAKITAVSANAKHPYHVIHT
NGTSNVYGWVDASAVSVAGGSAAVNYMVRVKITDLNIRSGPGTNNAKKGVIKPGVYTIVQ
EATGTGASKWGKLKSGAGWISLDHCEKM

Enzyme Prediction     

No EC number prediction in MGYG000001434_00253.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18013	Phage_lysozyme2	3.19e-36	3	166	1	139	Phage tail lysozyme. This domain has a lysozyme like fold. It is found in the tail protein of various phages probably giving them the ability to degrade the host cell wall peptidoglycan layer.
pfam01510	Amidase_2	2.56e-15	202	338	2	121	N-acetylmuramoyl-L-alanine amidase. This family includes zinc amidases that have N-acetylmuramoyl-L-alanine amidase activity EC:3.5.1.28. This enzyme domain cleaves the amide bond between N-acetylmuramoyl and L-amino acids in bacterial cell walls (preferentially: D-lactyl-L-Ala). The structure is known for the bacteriophage T7 structure and shows that two of the conserved histidines are zinc binding.
cd06583	PGRP	2.96e-07	206	339	12	126	Peptidoglycan recognition proteins (PGRPs) are pattern recognition receptors that bind, and in certain cases, hydrolyze peptidoglycans (PGNs) of bacterial cell walls. PGRPs have been divided into three classes: short PGRPs (PGRP-S), that are small (20 kDa) extracellular proteins; intermediate PGRPs (PGRP-I) that are 40-45 kDa and are predicted to be transmembrane proteins; and long PGRPs (PGRP-L), up to 90 kDa, which may be either intracellular or transmembrane. Several structures of PGRPs are known in insects and mammals, some bound with substrates like Muramyl Tripeptide (MTP) or Tracheal Cytotoxin (TCT). The substrate binding site is conserved in PGRP-LCx, PGRP-LE, and PGRP-Ialpha proteins. This family includes Zn-dependent N-Acetylmuramoyl-L-alanine Amidase, EC:3.5.1.28. This enzyme cleaves the amide bond between N-acetylmuramoyl and L-amino acids, preferentially D-lactyl-L-Ala, in bacterial cell walls. The structure for the bacteriophage T7 lysozyme shows that two of the conserved histidines and a cysteine are zinc binding residues. Site-directed mutagenesis of T7 lysozyme indicates that two conserved residues, a Tyr and a Lys, are important for amidase activity.
smart00644	Ami_2	9.80e-07	200	336	1	126	Ami_2 domain.
COG3023	AmpD	0.002	225	297	61	141	N-acetyl-anhydromuramyl-L-alanine amidase AmpD [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFB75734.1	5.76e-200	5	504	9	443
QUO22979.1	1.09e-197	5	504	9	443
ADB89215.1	1.48e-91	181	364	15	198
CBL18646.1	7.86e-86	178	361	2	187
AFB76124.1	2.32e-66	176	377	3	200

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001434_00253.