CAZyme Information: MGYG000001434_02045

Basic Information

• Species: Butyricicoccus pullicaecorum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Butyricicoccaceae; Butyricicoccus; Butyricicoccus pullicaecorum
• CAZyme ID: MGYG000001434_02045
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346		38467.39	4.5439

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001434	3299523	Isolate	not provided	Europe

• Gene Location: Start: 157683; End: 158723 Strand: +

Full Sequence      

MKPMKLRLSALSMLTAAALAFSPMIPQAIPAAPAASTSSSFQSQDEAITPAQYQSMLGHG
MDVDWSKTSEGRANYQPQTVIDFAEAGIKHVRIRVKDDLTPDVLASLDRQIDDCLSHGLI
PVLAYQADAFKNDPSERNLEHVVAWWSTIAARYQDKSHALSFDLLIECTDALNQQPDRLN
EMIERVTAAIRQTNPDRIIMMSPRLRSNPAYLSELQVPSQANGYLMAEWHFYAAGPSKTN
EKKLWTTGTAAEKQLVLDQIQLALDWQAQTGIPTWVGAWMPGNYNDGDDYTLSEQMTFAA
FLCDSLDAAGIPFAVNSDTKFYDRQSGQWVTEMEPLRDLIFSPSAN

Enzyme Prediction     

No EC number prediction in MGYG000001434_02045.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	75	315	6.2e-27	0.9580152671755725

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	2.97e-12	78	300	27	257	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIB28168.1	2.55e-136	45	342	2	299
QCI58964.2	2.69e-136	37	345	19	328
QUF84801.1	2.82e-133	48	336	29	317
QMW91197.1	4.00e-133	48	336	29	317
BBK76626.1	4.00e-133	48	336	29	317

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4U5I_A	3.41e-17	37	343	65	380	ChainA, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],4U5I_B Chain B, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],4U5K_A Chain A, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],4U5K_B Chain B, Endoglucanase H [Acetivibrio thermocellus ATCC 27405]
4U3A_A	1.53e-16	37	343	65	380	ChainA, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],4U3A_B Chain B, Endoglucanase H [Acetivibrio thermocellus ATCC 27405]
5BYW_A	1.10e-13	37	343	65	391	ChainA, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],5BYW_B Chain B, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],5BYW_C Chain C, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],5BYW_D Chain D, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],5BYW_E Chain E, Endoglucanase H [Acetivibrio thermocellus ATCC 27405]
3RJY_A	9.25e-08	43	336	6	313	CrystalStructure of Hyperthermophilic Endo-beta-1,4-glucanase in complex with substrate [Fervidobacterium nodosum Rt17-B1]
3NCO_A	1.24e-07	142	336	119	313	Crystalstructure of FnCel5A from F. nodosum Rt17-B1 [Fervidobacterium nodosum Rt17-B1],3NCO_B Crystal structure of FnCel5A from F. nodosum Rt17-B1 [Fervidobacterium nodosum Rt17-B1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25472	1.52e-18	57	333	41	323	Endoglucanase D OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCD PE=3 SV=1
P16218	1.67e-15	37	343	316	631	Endoglucanase H OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000491	0.998586	0.000219	0.000297	0.000204	0.000179

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001434_02045.