CAZyme Information: MGYG000001434_02056

Basic Information

• Species: Butyricicoccus pullicaecorum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Butyricicoccaceae; Butyricicoccus; Butyricicoccus pullicaecorum
• CAZyme ID: MGYG000001434_02056
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
467	MGYG000001434_2|CGC1	52765.39	5.5177

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001434	3299523	Isolate	not provided	Europe

• Gene Location: Start: 171297; End: 172700 Strand: -

Full Sequence      

MSNALQRDLLRMAARVEREDGPKAAQDPHRLTFHIQPPTGWLNDPNGLCKYGEDYHVFFQ
YGPFDCTGGVKHWGHCKSRDLVHWEYLPILLCPDQPYDIHGVYSGSAYIEDGKMYLYYTG
NVKHEGDHDYIRTGRGHNTCLAISEDGETMASKQCLMENKDYPAGLTCHVRDPKVWKMDG
KYYMVQGARTLEDRGEVLIFQSEDKIHWTHCNTITTPEIFGYMWECPDLFEIDGQWFLCV
SPQGVAQTDDRFQNVYACGYFPLYGDFRGDCTLGEFQTLDKGFDFYAPQSFLDGTRRIQF
GWMGMPDAEYTNPTTAYGWQHCMTVPCVLTAKDGKILRNPVPELNALHGTLRQLSVTPGV
SESVKTFDLQYQTAGQPFELTIHDSVRLNWQDGVLTLSVPQGGAGRTTRVAHCAAPMSLR
ILADTSSVEVFVDGGATCMSTRCYPTSWGVRWTSGTGDAQLWDMKQS

Enzyme Prediction     

No EC number prediction in MGYG000001434_02056.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	34	338	1.1e-93	0.9897610921501706

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	1.23e-157	40	333	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	7.26e-143	21	445	5	444	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	2.12e-129	1	446	1	460	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
smart00640	Glyco_32	1.05e-108	34	435	1	437	Glycosyl hydrolases family 32.
pfam00251	Glyco_hydro_32N	1.35e-107	34	340	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCG05878.1	2.20e-208	3	447	2	446
CED94068.1	1.95e-159	3	446	2	453
QHB24857.1	9.71e-154	3	464	2	468
QEI32364.1	9.71e-154	3	464	2	468
CCG93499.1	1.11e-152	3	464	2	468

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	1.43e-72	33	447	29	461	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
6NU7_A	7.92e-59	23	447	26	465	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
6NUM_A	1.47e-58	33	444	43	485	Thestructure of GH32 from Bifidobacteium adolescentis [Bifidobacterium adolescentis],6NUN_A Structure of GH32 hydrolase from Bifidobacterium adolescentis in complex with frutose [Bifidobacterium adolescentis]
7BWB_A	2.19e-57	23	444	41	460	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
3PIG_A	9.33e-57	33	444	43	485	beta-fructofuranosidasefrom Bifidobacterium longum [Bifidobacterium longum],3PIG_B beta-fructofuranosidase from Bifidobacterium longum [Bifidobacterium longum],3PIJ_A beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum],3PIJ_B beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	2.97e-101	16	445	16	454	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
P37075	1.75e-86	22	459	19	454	Sucrose-6-phosphate hydrolase OS=Salmonella typhimurium OX=90371 GN=scrB PE=3 SV=1
P27217	3.83e-85	22	445	19	439	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3
A5EZZ8	9.77e-83	28	464	92	533	Probable sucrose-6-phosphate hydrolase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=cscA PE=3 SV=1
Q56660	2.09e-81	28	464	92	533	Probable sucrose-6-phosphate hydrolase OS=Vibrio cholerae OX=666 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001434_02056.