CAZyme Information: MGYG000001436_01004

Basic Information

• Species: Paenibacillus_F sp000411255
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_F; Paenibacillus_F sp000411255
• CAZyme ID: MGYG000001436_01004
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
261	MGYG000001436_1|CGC15	27457.01	5.121

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001436	6290841	Isolate	not provided	not provided

• Gene Location: Start: 1137334; End: 1138119 Strand: -

Full Sequence      

MVSIDPRLMKELLKLEMLNKSTLFSGAGGAVSGASESGEEFSSLLNTLLMEQGGLSADPT
GEDALGILPLEALQGAWTGSAGAVPAAAGTGLSVQRQAKALRSYETAAGAVQASLPASAR
EAAYDAYIVQASERTGVDPALIKAVIRQESSFNPNTVSRAGAKGLMQLMDGTANGLGVTN
AFDPQQNIQGGAQYLSYQLKRFDGNVGVALAAYNAGPGRVNKLGIKNDSDLLEKMHLLPN
ETQQYVKKVMNAKERYDREFT

Enzyme Prediction     

No EC number prediction in MGYG000001436_01004.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	131	255	3.5e-34	0.8518518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	7.19e-50	124	255	4	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	2.31e-47	123	258	5	151	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	5.68e-45	139	252	1	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13403	MLTF-like	1.19e-38	128	257	1	157	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	4.73e-36	128	222	1	101	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAV20386.1	1.79e-172	1	261	1	261
ALS21330.1	2.40e-63	3	257	7	227
AFC32241.1	4.99e-61	3	257	8	233
AFH64543.1	4.99e-61	3	257	8	233
AEI42635.1	8.15e-61	3	257	24	249

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	2.43e-14	128	250	420	549	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	2.43e-14	128	250	424	553	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	2.44e-14	128	250	430	559	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	2.45e-14	128	250	434	563	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	2.46e-14	128	250	440	569	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	9.65e-34	125	252	61	178	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	2.43e-30	124	250	1422	1538	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	2.43e-30	124	250	1422	1538	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
P27380	1.81e-19	131	221	14	103	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
Q3KHL5	6.66e-14	124	244	289	421	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001436_01004.