CAZyme Information: MGYG000001436_02130

Basic Information

• Species: Paenibacillus_F sp000411255
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_F; Paenibacillus_F sp000411255
• CAZyme ID: MGYG000001436_02130
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
761	MGYG000001436_1|CGC25	84769.2	5.7092

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001436	6290841	Isolate	not provided	not provided

• Gene Location: Start: 2410970; End: 2413255 Strand: +

Full Sequence      

MNPSTETLLKELTLEEKAALCSGLNMWMTKGIERLDIPSIHMYDGTNGIRKTNSDEEMGI
TGENIPATCYPTGSAIGSSWNTELLHEVGVALGAESKQMGVELLLGPGINMKRTPLGGRN
FEYYSEDPCLSGELGAAFVNGLQSQGVGASVKHFACNNQEYEKMVTSSEVDERTLREIYL
SAFERIVKKSNPWTIMCSYNLVNGSYASENEHLLHHILREEWGYEGVVLSDWTAVNDRLR
GLKAGLDLEMPGPAQYNTNAIVEAVRNGQLSEAQLDKAVRRILELVRKTIGTGSGNEKQH
PIADYHALARKAAAESMVLLKNDNHILPIDPAKVSSIAVIGKFAKQPRIQGAGSAKVTPT
HVDIPWEEMAKVAGDSVSFTYAEGYPQDDSVDENLIRESAELAAKTDMAVLFVGQPEYAE
SEMHDLDGIELPLHQIKLIEAVSAVQPKCIVITSSGTALAMRPWVHHVPGILHSWLTGQG
SGRAIAEILFGRINPSGKLSETFPVKLSDNPSHMRIRGENGKLYYREGLFIGYRYYDKKE
IAPQFPFGHGLSYTTFAYSNLKAVQNGGTVKVTFSVENTGAMYGKEVVQLYVHDEECKWV
RPEKELKAFAKLALHPGQKKDVSFTLEERDLAYYNTKYNKWVAETGYFQFALGSSSRDIR
IRERVYCDFGKEVIALHKFSLLSDWLGNPTAKSVLVESLEEMNAHVSDKVYLNEEFVGFW
GDFPVIKIFQMFGQSWLADTSPDQLLDQLIQSFEHKRRTEL

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	31	251	1.5e-65	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	5.31e-92	34	660	101	758	beta-glucosidase BglX.
COG1472	BglX	2.48e-70	34	347	57	367	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	3.67e-67	317	533	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	1.17e-57	7	627	55	743	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	1.05e-37	55	285	73	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SYX84937.1	0.0	1	758	1	757
AJS60218.1	0.0	4	756	3	753
ANY71326.1	0.0	1	757	1	755
SMF85048.1	0.0	1	758	12	766
AYB47803.1	0.0	1	757	1	755

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	4.67e-235	8	702	8	704	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.75e-197	1	704	1	700	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	2.20e-140	8	662	7	708	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	3.39e-139	8	662	7	708	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	1.50e-127	6	659	7	828	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	2.56e-234	8	702	8	704	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
E7CY69	2.97e-189	1	695	1	700	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
F6C6C1	2.97e-189	1	695	1	700	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
Q4WU49	1.08e-138	6	659	7	822	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
A1DFA8	1.52e-138	6	659	7	822	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001436_02130.