CAZyme Information: MGYG000001436_02397

Basic Information

• Species: Paenibacillus_F sp000411255
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_F; Paenibacillus_F sp000411255
• CAZyme ID: MGYG000001436_02397
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
121	MGYG000001436_1|CGC27	13447.17	9.7917

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001436	6290841	Isolate	not provided	not provided

• Gene Location: Start: 2687394; End: 2687759 Strand: +

Full Sequence      

MNTYVVQPGDTLYLIANRYNTTVEALLRANNLSTPYVYVGQTLYIPAPGPGPGPGPWPGP
GPGPAPGPGPGPGFGNLEQRVNRLEREFNQLNREVGRLTREVNRLDQRLDRLEQRVTRLE
R

Enzyme Prediction     

No EC number prediction in MGYG000001436_02397.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	4	46	1.5e-16	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01476	LysM	1.13e-17	4	45	1	42	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
cd00118	LysM	3.41e-16	3	45	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	1.81e-14	3	45	1	44	Lysin motif.
COG1388	LysM	2.18e-11	3	43	68	108	LysM repeat [Cell wall/membrane/envelope biogenesis].
PRK10783	mltD	3.09e-09	3	45	345	387	membrane-bound lytic murein transglycosylase D; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAV16226.1	3.10e-27	1	84	1	88
ALS24302.1	5.37e-11	1	46	1	46
QIZ08316.1	2.05e-10	3	46	8	51
QGP92021.1	3.95e-10	3	46	35	78
QOT00870.1	4.30e-10	4	47	3	47

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UZ2_A	5.60e-10	3	47	4	48	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]
4XCM_A	1.11e-08	3	47	4	48	Crystalstructure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4XCM_B Crystal structure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O07532	2.61e-06	3	46	28	71	Peptidoglycan endopeptidase LytF OS=Bacillus subtilis (strain 168) OX=224308 GN=lytF PE=1 SV=2
Q01837	3.60e-06	2	45	196	239	Probable endopeptidase p60 OS=Listeria ivanovii OX=1638 GN=iap PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001436_02397.