CAZyme Information: MGYG000001436_02475

Basic Information

• Species: Paenibacillus_F sp000411255
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_F; Paenibacillus_F sp000411255
• CAZyme ID: MGYG000001436_02475
• CAZy Family: SLH
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1684		181727.36	5.5591

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001436	6290841	Isolate	not provided	not provided

• Gene Location: Start: 2780057; End: 2785111 Strand: -

Full Sequence      

MEWHCINLMKLGCSMKALKQSFVWRWLVLLLCTSMVFSTYLTVVSGQASAQPADIKGHWA
EKELGEWHDKGLIQGYSDGSLQPDNAITRAELMALINRYYKLTASAPIQFTDVTAEQWQY
EQISKAVAAGYVDGYSDGSIRPDQPVSRQESAVMLSKLLKLGEASEDALKNIKDAASIAD
WSKGAVSAMVAKGVIEGYEDGTFRPAGKLTRAETVVLLGRAPSLQTVSYDKAGTFGPASG
TETVNGDVAVNVSGVTLQNTVIQGNLLLGKGIGNGDVTLKNVKVAGTVTVNGGGENSIHL
VDTILVKVIVHKETGVVRLVAQGNTSVQQTIVQSSVKLEESSLTGAGFIDVIFPKELPAG
STAQLIGAFNSLHVLASGIKIEISKGSIGKVTVDGSDTTLAVGNDASIVSLVLNALAKIT
GYGSVESVTVNEGGKGSSFEKAPVKVDGPQKGSIIIGLPIGGGWGGSGGSSGGGSTETAK
KVIAYVPGWKNWSASNPIDAAKLTHINYAFTHVKDNKIVSLPAQNDDANYAYLQSLKKDN
PKLKILPSVGGWGADGFSDAALTESARNTFADSIIEYVKKYKLDGVDLDWEYPTQSADGV
MKARPEDKQNFTLMLQTIREKLNALGSQDGKYYELTIAVGATQKYLDGVEIEKITPLLDN
INLMTYDFAGQWVQNTEHHTNLYAGNLSVDASVKLYLANKVPASKIVIGGAFYGHLWTDV
EAVGGKILGQKAVGNGATPTYNEIISNYNEAGGYKRYWDNEAKAPYLYSEQTKVFLSYDD
PQSLHEKGGYVLNQKLGGAMFWEYSQDQTGALLDALVKGVQGKTLNPDTTTVPAAPAVTG
VSEGQTYKTGVLPNWKDAAGTASGATLNGAAYTKGTGITEAGEYTLVVTAAHGKSGKTAS
TTVKFKVDPQTKVIAYVGGWKNWSEAKPVDASKLTHINYAFTHVKDNKIVPIEVQNDDAN
YAYLHSLKAQNADLKTLISVGGWGADGFSDAALTEASRQTFTDSIIDYVKKYNLDGVDLD
WEYPTQSADGVMKARPEDKQNFTSLLQLMRDKLNALGLETNRYYELTIAVGAGSGYLKGV
EIDKITPLLDNMNLMTYDLSGGWVPKTEHHTNLYGSGNNSVDQSVQLYKKNGVPANKIVI
GAAFYSHLWTNVESSANNGLGQKAVGTGATPTYSVTLATYSEANGYTRYWDQDSKAPYLY
NAQTGIFISFDDPESMAEKAAYTLKEKLGGAMFWEYSQDETGALLDALVNGLKGNPYTPD
TTSVPAAPQIANVTDGQTYTTGVLPNWTDAPGTVGVATLNGEEYIKGTGITEAGDYTLVV
TAVHGKSGKTASTTVKFKVDPRKKVIAYIAGWEDWSVTNSVYANKLTHLNYSFTLVKDNK
IITRPEQKDDQNYQYIHSLKAQNPNLKVLFAVGGWGADGFSDAVLTNEARDTFSNSIIDY
IKKYKLDGVDIDWEYPTISADGVMKARPEDKHNYTLFLQMLRDKLNQLGLADNKYYELSM
AAGAGPSHLKALEAAEISKYLDNFNIMTYDYSGGWVQKTEHHTNVYGPGLSMETVVKRFI
DAKVPANKIVVGIAFYSHLWTDVQSTANNGLGQAATGSGNTPTYNEILEKYNAANGYVRY
WDDAAKAPYLFNGSTWLSYDDPESIKAKAQFVQDQGLGGAMFWEYSMDKSGALLDALINV
IPVK

Enzyme Prediction     

No EC number prediction in MGYG000001436_02475.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	479	809	2.9e-80	0.9459459459459459
GH18	1342	1670	1.7e-78	0.9459459459459459
GH18	911	1241	1.3e-77	0.9425675675675675
CBM54	231	336	4.5e-29	0.8859649122807017
SLH	110	150	3.6e-16	0.9523809523809523

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06548	GH18_chitinase	3.65e-120	482	807	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
cd06548	GH18_chitinase	2.87e-116	913	1239	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
cd06548	GH18_chitinase	1.05e-111	1345	1668	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
smart00636	Glyco_18	3.21e-100	481	807	1	334	Glyco_18 domain.
smart00636	Glyco_18	4.39e-99	912	1239	1	334	Glyco_18 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAV16301.1	0.0	15	1684	1	1669
BAM67143.1	0.0	25	1253	10	1415
BBH23221.1	4.23e-111	50	443	29	430
ALS25414.1	7.36e-111	19	446	3	426
QGQ95647.1	1.64e-109	27	446	11	430

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GZT_B	4.73e-232	297	1253	1	1133	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
5GZU_A	4.93e-211	477	1253	23	882	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZU_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_A Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
6INX_A	1.22e-91	502	821	26	343	Structuralinsights into a novel glycoside hydrolase family 18 N-acetylglucosaminidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
1ITX_A	3.95e-71	481	816	13	415	ChainA, Glycosyl Hydrolase [Niallia circulans]
6KST_A	1.61e-70	912	1252	8	370	Crystalstructure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20533	1.72e-70	481	907	45	529	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
Q9W5U2	3.51e-58	908	1668	962	1753	Probable chitinase 10 OS=Drosophila melanogaster OX=7227 GN=Cht10 PE=2 SV=2
Q13231	2.12e-47	1344	1668	23	363	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
E9ERT9	1.26e-46	476	830	30	405	Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chit1 PE=3 SV=1
Q6RY07	6.77e-46	1367	1675	52	373	Acidic mammalian chitinase OS=Rattus norvegicus OX=10116 GN=Chia PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.474913	0.516856	0.005068	0.001048	0.000593	0.001506

TMHMM  Annotations     

start	end
21	43