CAZyme Information: MGYG000001436_03344

Basic Information

• Species: Paenibacillus_F sp000411255
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_F; Paenibacillus_F sp000411255
• CAZyme ID: MGYG000001436_03344
• CAZy Family: PL12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
707	MGYG000001436_2|CGC8	81267.86	7.6273

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001436	6290841	Isolate	not provided	not provided

• Gene Location: Start: 495049; End: 497172 Strand: +

Full Sequence      

MRNQLRMMQNMGLGWTLFRIKYELKKRAGFLEKEFPAVSMTEEEFLKRWSSHAASPDQVV
REWRAQARPFFFHPDKLNGLKPVLQKALGASEQELLNQADRICEGTFTYFSRWNVHQGTP
NWHWNPITNEESPRDLHWSKIPDLSGAFGDIKYIWELSRFSFAYTLVRAYALTGSSLYPE
TFWNLFEDWVKNNPEERGVNYKCCQEMSLRVMAWIFALYAFANHSSSMDKRVFSLLKQVY
CHTDHIDKHFDFALKSVKNNHTISEAAGLYTVGLLFPFFDRSGRWKKKGFRHLEAEGMWQ
IYEDGSYLQHSMNYHRLVVQDYTWALRLAELNGETFSNKLKERLYKTFDFLYQFQDEATG
RLPNYGMNDGALIHPLSQCEYLDYRPQLGAFYFILTGKRLYPDGPHEESLVWLAGESASS
APRDSFPRAALKAYPEGGYYSIRMNGGSAMIRCGTYRHRPAQADMLHLDIWREGTNVICD
AGTYSYNTDAEWSAYFMGTASHNTVMIGDDDQMEKGSRFIWYNWTKSHTKRAEAAADGMT
LFEGEHYGYGPLIHRRAVIQSDAVIAVIDEIAGDFNGTERAISASWLSAARGAKATGEKG
LIELETPTGPYFIETLDTQSSTFRIYHGDEKARRGWRSLYYGEKEPAYQIVRSLRSGKPV
RLVTVLSPVAGQVTYDPGQNLLRIQERSLRLNPVGTGAILSQEKVTL

Enzyme Prediction     

No EC number prediction in MGYG000001436_03344.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL12	437	569	3.3e-35	0.9855072463768116

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07940	Hepar_II_III	4.07e-29	427	651	2	220	Heparinase II/III-like protein. This family features sequences that are similar to a region of the Flavobacterium heparinum proteins heparinase II and heparinase III. The former is known to degrade heparin and heparin sulphate, whereas the latter predominantly degrades heparin sulphate. Both are secreted into the periplasmic space upon induction with heparin.
pfam16889	Hepar_II_III_N	2.84e-19	155	387	99	338	Heparinase II/III N-terminus. This is the N-terminal domain of heparinase II/III proteins. It is a toroid-like domain.
cd02850	E_set_Cellulase_N	0.004	546	625	6	86	N-terminal Early set domain associated with the catalytic domain of cellulase. E or "early" set domains are associated with the catalytic domain of cellulases at the N-terminal end. Cellulases are O-glycosyl hydrolases (GHs) that hydrolyze beta 1-4 glucosidic bonds in cellulose. They are usually categorized into either exoglucanases, which sequentially release terminal sugar units from the cellulose chain, or endoglucanases, which also attack the chain internally. The N-terminal domain of cellulase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QED49189.1	4.87e-249	5	695	5	691
QFY72029.1	1.08e-246	1	695	1	692
AXI10466.1	3.80e-229	1	695	1	693
QUW21251.1	9.25e-214	1	705	1	692
ACB86087.1	1.80e-170	6	663	8	669

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001436_03344.