CAZyme Information: MGYG000001436_03518

Basic Information

• Species: Paenibacillus_F sp000411255
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_F; Paenibacillus_F sp000411255
• CAZyme ID: MGYG000001436_03518
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402		44191.78	7.3918

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001436	6290841	Isolate	not provided	not provided

• Gene Location: Start: 681518; End: 682726 Strand: +

Full Sequence      

MTKRIFFGLSGGLGPVLRCLPVAEHFRRSGHTAAFSIYGEGSAAFIESRGFKHLPDDDPT
VPSAERMIAGGPVFYNLDHYYAGAGLLDPDFVQAWIHHRIRMLEKFNADLVITDMSPHTA
IAARYLGIPVASITQACFHPDGQPMHYWGRPPRNLPRVTPVVNRVLDRLGLPDIRRMEQL
NAGTLNFIPGIPEMDPVYTNGVRYVGPIEYPAAGPAGARLPDEPFVLVYPGRLQDTAGAT
GLQLLNHVAEAFGGKEEAVVIAASDGLPDRPKAGLPGNITVIPYFNSHMLENCRLFIHHG
GHGSCLSAIMKGIPSLILPTHTEREFNARKVQETGAGEYILPGTFTADHLYKLAMYVAED
GYKERAGELALLIRSRNYGGAREIYKRCMSLMNRRALALEEL

Enzyme Prediction     

No EC number prediction in MGYG000001436_03518.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	7	375	2.1e-27	0.9476439790575916

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1819	YjiC	3.68e-33	3	396	2	403	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
cd03784	GT1_Gtf-like	3.57e-25	4	377	2	392	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
PHA03392	egt	7.84e-07	275	376	344	449	ecdysteroid UDP-glucosyltransferase; Provisional
cd03785	GT28_MurG	0.001	4	353	1	317	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAV17307.1	1.49e-292	1	402	1	402
QKS43710.1	3.80e-145	1	396	1	397
AJQ26603.1	4.96e-86	3	395	6	405
AZK47453.1	1.62e-60	2	381	3	403
AZT89561.1	5.04e-41	3	384	2	401

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3OTG_A	3.05e-14	4	370	22	387	CrystalStructure of CalG1, Calicheamicin Glycostyltransferase, TDP bound form [Micromonospora echinospora],3OTH_A Crystal Structure of CalG1, Calicheamicin Glycostyltransferase, TDP and calicheamicin alpha3I bound form [Micromonospora echinospora],3OTH_B Crystal Structure of CalG1, Calicheamicin Glycostyltransferase, TDP and calicheamicin alpha3I bound form [Micromonospora echinospora]
2YJN_A	1.40e-09	86	360	126	403	Structureof the glycosyltransferase EryCIII from the erythromycin biosynthetic pathway, in complex with its activating partner, EryCII [Saccharopolyspora erythraea NRRL 2338]
3D0R_A	9.26e-09	4	330	22	343	Crystalstructure of calG3 from Micromonospora echinospora determined in space group P2(1) [Micromonospora echinospora],3D0R_B Crystal structure of calG3 from Micromonospora echinospora determined in space group P2(1) [Micromonospora echinospora],3OTI_A Crystal Structure of CalG3, Calicheamicin Glycostyltransferase, TDP and calicheamicin T0 bound form [Micromonospora echinospora],3OTI_B Crystal Structure of CalG3, Calicheamicin Glycostyltransferase, TDP and calicheamicin T0 bound form [Micromonospora echinospora]
6KQW_A	3.74e-08	222	360	219	354	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
6KQX_A	3.79e-08	222	360	219	354	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168],7BOV_A Chain A, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q54824	2.44e-12	202	369	228	397	TDP-daunosamine transferase DnrS OS=Streptomyces peucetius OX=1950 GN=dnrS PE=3 SV=1
Q9F2F9	8.56e-12	202	375	192	358	Elloramycin glycosyltransferase ElmGT OS=Streptomyces olivaceus OX=47716 GN=elmGT PE=1 SV=2
A4F7P3	7.31e-09	86	360	106	383	3-alpha-mycarosylerythronolide B desosaminyl transferase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) OX=405948 GN=eryCIII PE=1 SV=1
Q58652	9.03e-09	4	386	2	360	Uncharacterized glycosyltransferase MJ1255 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1255 PE=3 SV=2
Q9XC67	7.73e-08	203	360	270	426	Demethyllactenocin mycarosyltransferase OS=Streptomyces fradiae OX=1906 GN=tylCV PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999792	0.000240	0.000003	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001436_03518.