CAZyme Information: MGYG000001436_04446

Basic Information

• Species: Paenibacillus_F sp000411255
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_F; Paenibacillus_F sp000411255
• CAZyme ID: MGYG000001436_04446
• CAZy Family: CBM70
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352		38017.06	4.8714

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001436	6290841	Isolate	not provided	not provided

• Gene Location: Start: 1652258; End: 1653316 Strand: +

Full Sequence      

MTSMSKRISVFLFFCFMMQALSFGTAVHASELQPDLVSNGGFESAKSGAGKWEAGVEPVG
WGLWLASGTGKASVTKDVYHTGTQAVQLEHLALSRTGLSQDVPITGGQTYKLSVWVKTKD
VNSGIGVFVRTQFFKSIKGLDGKTQDDKIGSGPSTEELTGTQDWMKREVILSAPEEAKYI
RLEPFFETGTGTVWFDDISLVKWNSVTGLALDQTNVTLEKLQTAVLTAKVTPENVSGLSL
QWRVDNKDVVQVEAQGPLAVLTGLKPGKAIVTVMTDDGTFAATSEITVKEASIPGDLTND
GKITVGDLAMAAAHFGKDTNSPDWETVKAADVNGDHKIDRSDLMWFTERIFP

Enzyme Prediction     

No EC number prediction in MGYG000001436_04446.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM70	35	202	1.1e-32	0.9751552795031055

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14254	Dockerin_II	1.77e-10	295	347	1	50	Type II dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type II dockerins, which are responsible for mediating attachment of the cellulosome complex to the bacterial cell wall.
cd14256	Dockerin_I	1.57e-09	294	350	1	56	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
COG5492	YjdB	1.29e-08	188	301	163	274	Uncharacterized conserved protein YjdB, contains Ig-like domain [General function prediction only].
pfam00404	Dockerin_1	2.49e-08	295	345	1	50	Dockerin type I repeat. The dockerin repeat is the binding partner of the cohesin domain pfam00963. The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome. The dockerin repeats, each bearing homology to the EF-hand calcium-binding loop bind calcium.
pfam02368	Big_2	2.72e-08	207	286	1	77	Bacterial Ig-like domain (group 2). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in bacterial and phage surface proteins such as intimins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAV18210.1	3.77e-247	1	352	1	352
AZS13398.1	2.19e-69	1	293	1	297
QTH43589.1	7.14e-66	35	293	38	295
SMF90851.1	2.69e-58	1	293	1	295
QNK58518.1	7.67e-57	1	252	1	251

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4D0Q_A	3.33e-13	35	202	3	155	HyaluronanBinding Module of the Streptococcal Pneumoniae Hyaluronate Lyase [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q54873	8.63e-12	35	276	54	272	Hyaluronate lyase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0314 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000365	0.998818	0.000194	0.000227	0.000182	0.000166

TMHMM  Annotations     

start	end
7	29