CAZyme Information: MGYG000001436_05326

Basic Information

• Species: Paenibacillus_F sp000411255
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_F; Paenibacillus_F sp000411255
• CAZyme ID: MGYG000001436_05326
• CAZy Family: GH46
• CAZyme Description: Chitosanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315		34075.12	7.2128

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001436	6290841	Isolate	not provided	not provided

• Gene Location: Start: 2596147; End: 2597094 Strand: +

Full Sequence      

MQTKRSVSVRKRVKSCMNAALSVGLASTLLLTSVLLPGNALANSNPAQGEAYAAPANSHD
SNFSPSTLQFLKSKTGLDGEQWDNIMKLVNKAEQDSLKWTEYYGYCEDIDDDRGYTIGIF
GATTGGSNDTGPDGPALFKEYDAVKGASNPSVEGGLARIGAHGSMKGSILKITDSEKVFC
GKIKGLEDDPAWREAMWHTFYNVYIKYSVEQARNRGFNSALTIGSFVDTALNQGAEGDSG
SLAGILAKSGSSTNEKTFMTNFYAKRTLVVDTNEYNQPPNGKNRVKQWSSLLNTGETDLK
DADVAVKKATNWIMK

Enzyme Prediction     

EC	3.2.1.132

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH46	76	300	4.5e-77	0.9954954954954955

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00978	chitosanase_GH46	2.43e-56	79	302	1	221	chitosanase belonging to the glycosyl hydrolase 46 family. This family is composed of the chitosanase enzymes which hydrolyzes chitosan, a biopolymer of beta (1,4)-linked-D-glucosamine (GlcN) residues produced by partial or full deacetylation of chitin. Chitosanases play a role in defense against pathogens such as fungi and are found in microorganisms, fungi, viruses, and plants. Microbial chitosanases can be divided into 3 subclasses based on the specificity of the cleavage positions for partial acetylated chitosan. Subclass I chitosanases such as N174 can split GlcN-GlcN and GlcNAc-GlcN linkages, whereas subclass II chitosanases such as Bacillus sp. no. 7-M can cleave only GlcN-GlcN linkages. Subclass III chitosanases such as MH-K1 chitosanase are the most versatile and can split both GlcN-GlcN and GlcN-GlcNAc linkages.
pfam01374	Glyco_hydro_46	1.84e-19	87	262	1	171	Glycosyl hydrolase family 46. This family are chitosanase enzymes.
cd16889	chitinase-like	2.13e-11	85	232	1	105	chitinase-like domain. This family includes proteins such as chitinases, chitosanase, pesticin, and endolysin, which are involved in the degradation of 1,4-N-acetyl D-glucosamine linkages in chitin polymers and related activities. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Chitosanase enzymes hydrolyze chitosan, a biopolymer of beta (1,4)-linked-D-glucosamine (GlcN) residues produced by partial or full deacetylation of chitin. Pesticin (Pst) is a anti-bacterial toxin produced by Yersinia pestis that acts through uptake by the target related bacteria and the hydrolysis of peptidoglycan in the periplasm. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAV19074.1	1.75e-206	1	315	1	315
AMO95218.1	1.29e-155	53	315	103	365
SYX83235.1	1.76e-149	9	315	7	299
AJS58858.1	2.91e-149	53	315	81	343
ADO57830.2	3.72e-149	53	315	68	330

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QGI_A	2.29e-139	58	315	2	259	ChainA, Protein (chitosanase) [Niallia circulans]
2D05_A	4.62e-139	58	315	2	259	ChainA, Chitosanase [Niallia circulans]
5HWA_A	6.55e-139	58	315	2	259	ChainA, Chitosanase [Niallia circulans]
4ILY_A	6.22e-09	65	245	6	175	Abundantlysecreted chitosanase from Streptomyces sp. SirexAA-E [Streptomyces sp. SirexAA-E],4ILY_B Abundantly secreted chitosanase from Streptomyces sp. SirexAA-E [Streptomyces sp. SirexAA-E]
4OLT_A	1.74e-06	81	270	21	205	Chitosanasecomplex structure [Pseudomonas sp. LL2(2010)],4OLT_B Chitosanase complex structure [Pseudomonas sp. LL2(2010)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P33673	1.36e-138	54	315	40	301	Chitosanase OS=Niallia circulans OX=1397 GN=csn PE=1 SV=2
P48846	6.34e-06	40	125	18	95	Chitosanase OS=Nocardioides sp. (strain N106) OX=47919 GN=csn PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001021	0.998073	0.000280	0.000248	0.000180	0.000158

TMHMM  Annotations     

start	end
20	42