CAZyme Information: MGYG000001436_05379

Basic Information

• Species: Paenibacillus_F sp000411255
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_F; Paenibacillus_F sp000411255
• CAZyme ID: MGYG000001436_05379
• CAZy Family: CBM5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
521	MGYG000001436_2|CGC34	55324.49	7.0474

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001436	6290841	Isolate	not provided	not provided

• Gene Location: Start: 2661808; End: 2663373 Strand: -

Full Sequence      

MNWQFIRSQSPKQVLFRVLLIASLLVSLLPFLGLNTQQASAAANVSTAAAACTDAAWDST
KVYTGGQKVSYNGKVFEAKWWTQGETPSQTNTWGSWKYVSDCTGGGGTTDTTAPTAPAGL
TLTGKTSTSVSLSWNASTDNVGVTGYNVYNGSALATSVTGTTATVTGLAANTAYSFSVKA
KDAAGNLSAASNVLAVTTSSDGGGTTPLAKINGAYVASWHFPAVNTVPANKLTHIFYAFA
DVANNGVSGGDTSQIAQLVTLKQKNPDLKVLISVGGWGRSDGFTSAASTDANRTAFANSA
LQYIRANKLDGIDLDWEYPTTADKQNYTLFLKKLREVLDAGSAADGRTGNKKYEITAATG
ASEYGIQGIDLGSVHPYFTFINIMTYDMQVGANTHHTNLYTSSLNSSYSVDNAVKLYKGR
GVPSEKIVIGGAFYSHGAGDYTYDELKASYINKNGWTRQWDDVAKAPYLTNGSSMLSYDD
AESLTQKVNYLKSNNLGGIMFWEYGQNLGAELVDAIYTALK

Enzyme Prediction     

No EC number prediction in MGYG000001436_05379.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	213	512	1.2e-71	0.9425675675675675
CBM5	55	96	2e-16	0.95

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06548	GH18_chitinase	1.77e-112	212	506	1	321	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
smart00636	Glyco_18	8.85e-86	213	506	3	333	Glyco_18 domain.
pfam00704	Glyco_hydro_18	6.69e-83	213	506	3	306	Glycosyl hydrolases family 18.
cd02872	GH18_chitolectin_chitotriosidase	1.22e-74	215	502	4	336	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
COG3325	ChiA	2.71e-68	205	520	33	436	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAV19122.1	0.0	1	521	1	519
BAC76692.1	0.0	1	521	1	518
QJC52690.1	1.85e-176	7	521	6	421
QGG57095.1	3.24e-172	7	521	6	441
ASO66301.1	6.51e-172	40	521	18	421

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6INX_A	6.10e-81	215	521	10	343	Structuralinsights into a novel glycoside hydrolase family 18 N-acetylglucosaminidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
5GZU_A	1.02e-77	214	520	30	391	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZU_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_A Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
5GZT_B	1.42e-76	214	520	281	642	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
1ITX_A	7.16e-61	210	520	13	419	ChainA, Glycosyl Hydrolase [Niallia circulans]
6KST_A	4.07e-54	214	520	11	370	Crystalstructure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20533	9.50e-58	210	520	45	451	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
P36909	2.77e-44	56	504	80	591	Chitinase C OS=Streptomyces lividans OX=1916 GN=chiC PE=2 SV=1
P11220	5.86e-43	113	521	141	610	Chitinase 63 OS=Streptomyces plicatus OX=1922 GN=chtA PE=1 SV=2
E9ERT9	3.91e-42	211	503	40	380	Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chit1 PE=3 SV=1
P48827	3.55e-40	212	503	40	379	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000546	0.998717	0.000208	0.000200	0.000155	0.000145

TMHMM  Annotations     

start	end
13	35