CAZyme Information: MGYG000001437_00452

Basic Information

• Species: Staphylococcus schleiferi
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus schleiferi
• CAZyme ID: MGYG000001437_00452
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
860	MGYG000001437_1|CGC7	100549.41	6.4363

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001437	2461191	Isolate	not provided	not provided

• Gene Location: Start: 472034; End: 474616 Strand: +

Full Sequence      

MNFREIKYLLFGNPKPFRMTREKIDFKEEELTTLQNIADVIEQDEGKGLYEIYRSHALKP
YVDYIRTYHQVGKGDQNASFDLVNTTEQTLLNQEKLPLTVGIVADTFLYDALKGACNLIY
INEKHKDEHYDFVIIASTWKGIDGYWEGNTNVHSEKYEELKRLVKNFQDRAIPIVFFNKE
DPINFEVFQSHAQWFEHVITTEQDFVLAYKEKLGIAKVKQMRFPINPRIHHPIASSRDVA
DKKIVFAGSWLDKYEERAADIQTILEGVIQNNWDLTIYDRNLWTNKKKYQFPAAFLPYIA
APLNHMNTMKMHRAYPFAINVNTIKYSQTMCANRIFELQGMGVFMLSNYNTFVNAHFPQV
QMVFEPQDVKKINRLDSVLIKRAQSIGIQKVMLSTAHQLKWLNDVSQFIGLSSQSSNLPE
LTVVIEEADTKAMEMFEAQTYEWKTCVSSTDDIHTDYYTFFSSDFNYDPEYLSDFAAAFM
YTDVRFITKRTEGYRWVSGYDSRYLTAFNQQHDNNQRGFALDITFVDSQNQIEAVPPVKP
ELSVIVPVHNNGTHLEHKCLRSIISHPLFPKLEVILVDDGSTDRYTSNLMKMYSQWYKNI
EVIHLDEASGSASTPRNIGIDYAKSDLITFLDPDNEWIGEGIDRLFEEITQNDEIDAVIG
NMLKVDQTETKKHDYYQQFVHVVHADMTRQTHQFLHDMKLKTASIQALIVRKSLLKKHQI
KMVPGALGQDSLFFLTMIHHAQAIKVVDATVHVYYAGIANSMTNQISEQFFRKYYLVERE
KVKFLKQHGYLSTYMNHRFNYYVKHWYISRINRTTEKDPNVLKAFLAIIDLYQHFDRPYD
AELVDEIEMMKNEVKEWGIY

Enzyme Prediction     

No EC number prediction in MGYG000001437_00452.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	543	677	4.3e-22	0.7647058823529411

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	1.23e-22	543	679	1	132	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	5.21e-20	544	661	1	114	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
PRK10073	PRK10073	9.04e-18	539	755	5	216	putative glycosyl transferase; Provisional
cd02525	Succinoglycan_BP_ExoA	1.43e-14	543	672	3	128	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
cd06423	CESA_like	8.37e-13	544	662	1	116	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGS47156.1	0.0	1	860	1	860
QPA33956.1	0.0	1	860	1	860
QPA23726.1	0.0	1	860	1	860
AKS67484.1	0.0	1	860	1	860
AKS74025.1	0.0	1	860	1	860

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S22_A	6.46e-06	529	652	173	295	Crystalstructure of the TgGalNAc-T3 in complex with UDP, manganese and FGF23c [Taeniopygia guttata],6S24_A Crystal structure of the TgGalNAc-T3 in complex with UDP, manganese and the peptide 3 [Taeniopygia guttata]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0H2UR96	2.81e-12	542	669	5	127	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
D4GYG7	4.23e-10	540	662	6	125	Glycosyltransferase AglE OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglE PE=1 SV=1
P11290	4.39e-09	541	769	7	228	Uncharacterized glycosyltransferase YibD OS=Escherichia coli (strain K12) OX=83333 GN=yibD PE=3 SV=2
Q5EA41	8.39e-08	499	666	136	302	Polypeptide N-acetylgalactosaminyltransferase 6 OS=Bos taurus OX=9913 GN=GALNT6 PE=2 SV=1
Q57022	2.76e-07	540	675	4	142	Uncharacterized glycosyltransferase HI_0868 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0868 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001437_00452.