CAZyme Information: MGYG000001437_01269

Basic Information

• Species: Staphylococcus schleiferi
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus schleiferi
• CAZyme ID: MGYG000001437_01269
• CAZy Family: GT51
• CAZyme Description: Monofunctional glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
268	MGYG000001437_1|CGC16	31052.4	10.1336

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001437	2461191	Isolate	not provided	not provided

• Gene Location: Start: 1326216; End: 1327022 Strand: -

Full Sequence      

MRRKDRMGKSAAQPHDNAPHYNTYYQPVGQPPKKQKPRRIFRTLIFVLIFIAALFIGLMY
MLSQQADVSDLKSIEQKDSYVSASQMPKYTRGAFIAVEDKRFYHHSGVDYKGSIRAIFAS
IKDKNRLQGGSTITQQLAKNFYYDNQQTVTRKLKEMFVARRIERTYSKEQILSYYMNNIF
YGDNHYTIESAARYYFGTTTNQQNTNLPQITVLQSAILASKVNAPSVYDVNDMSPAFINR
TKMTLEKMKQQNYISEQQYTEALQQLGA

Enzyme Prediction     

EC	2.4.1.129

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	74	249	6.1e-58	0.9548022598870056

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13481	PRK13481	2.55e-123	34	266	1	232	glycosyltransferase; Provisional
pfam00912	Transgly	2.30e-66	75	249	10	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	1.24e-63	31	265	2	257	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	7.73e-61	80	264	4	181	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	3.39e-59	44	265	13	247	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGS45796.1	7.45e-189	1	268	1	268
QPA25079.1	7.45e-189	1	268	1	268
QPA35309.1	7.45e-189	1	268	1	268
AKS68851.1	2.91e-186	1	268	1	268
AKS71074.1	2.91e-186	1	268	1	268

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZZK_A	1.47e-96	23	267	2	245	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3VMQ_A	4.24e-95	23	267	19	262	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMQ_B Chain B, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMR_A Chain A, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMS_A Chain A, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMS_B Chain B, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMT_A Chain A, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMT_B Chain B, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	4.76e-84	59	267	2	209	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	4.92e-84	59	267	3	210	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]
2OQO_A	4.89e-38	76	263	18	198	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4L7I0	1.53e-113	1	267	1	268	Monofunctional glycosyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=mgt PE=3 SV=1
Q5HN60	1.11e-103	19	267	21	268	Monofunctional glycosyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=mgt PE=3 SV=1
Q8CNQ3	1.11e-103	19	267	21	268	Monofunctional glycosyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=mgt PE=3 SV=1
Q49YR9	5.03e-100	1	267	1	269	Monofunctional glycosyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=mgt PE=3 SV=1
Q6GFI3	1.85e-97	1	267	1	268	Monofunctional glycosyltransferase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=mgt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999962	0.000061	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
40	62