CAZyme Information: MGYG000001437_01657

Basic Information

• Species: Staphylococcus schleiferi
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus schleiferi
• CAZyme ID: MGYG000001437_01657
• CAZy Family: GH46
• CAZyme Description: Chitosanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323	MGYG000001437_2|CGC4	36269.09	6.0459

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001437	2461191	Isolate	not provided	not provided

• Gene Location: Start: 317396; End: 318367 Strand: +

Full Sequence      

MKKTLKVALSSAVILSSFSSIAHVAHADQQLGQASAQQIAQKESDSNASHYMDANHDLRK
RIMALVGAAENTDTNYSHNYSYIDDIGDHRGYTAGVIGFTTGSDDMVHLVKHYNQINPNN
NLKKYLPALEKLAQAQSESHEGLDGFEQAWKDAAKNDRANLVKAQNYVLKKDYMDEAVQA
AKEDGLSQLGQYVYFDAIVKHGPGEFKKGGYKGKDPADWSFDELRERAMDKSGGKTPKTG
AKEADYLYAFLDGRFKATQKENENNGSKDNDVFDRLKVQQQFIKNQNFDLKLPLDFKMNG
EQFHLDQDAIQHYSNEDIDFDHA

Enzyme Prediction     

No EC number prediction in MGYG000001437_01657.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH46	59	291	3.3e-54	0.9684684684684685

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00978	chitosanase_GH46	1.15e-87	56	294	1	222	chitosanase belonging to the glycosyl hydrolase 46 family. This family is composed of the chitosanase enzymes which hydrolyzes chitosan, a biopolymer of beta (1,4)-linked-D-glucosamine (GlcN) residues produced by partial or full deacetylation of chitin. Chitosanases play a role in defense against pathogens such as fungi and are found in microorganisms, fungi, viruses, and plants. Microbial chitosanases can be divided into 3 subclasses based on the specificity of the cleavage positions for partial acetylated chitosan. Subclass I chitosanases such as N174 can split GlcN-GlcN and GlcNAc-GlcN linkages, whereas subclass II chitosanases such as Bacillus sp. no. 7-M can cleave only GlcN-GlcN linkages. Subclass III chitosanases such as MH-K1 chitosanase are the most versatile and can split both GlcN-GlcN and GlcN-GlcNAc linkages.
pfam01374	Glyco_hydro_46	5.35e-67	65	294	2	210	Glycosyl hydrolase family 46. This family are chitosanase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD7358578.1	1.45e-234	1	323	1	323
QGS46458.1	1.45e-234	1	323	1	323
AKS68206.1	1.28e-228	1	323	1	323
AKS70435.1	1.28e-228	1	323	1	323
AKS72583.1	1.28e-228	1	323	1	323

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ILY_A	2.50e-47	48	305	7	249	Abundantlysecreted chitosanase from Streptomyces sp. SirexAA-E [Streptomyces sp. SirexAA-E],4ILY_B Abundantly secreted chitosanase from Streptomyces sp. SirexAA-E [Streptomyces sp. SirexAA-E]
1CHK_A	2.76e-46	63	303	15	234	StreptomycesN174 Chitosanase Ph5.5 298k [Streptomyces sp. N174],1CHK_B Streptomyces N174 Chitosanase Ph5.5 298k [Streptomyces sp. N174]
4OLT_A	1.44e-45	63	305	26	247	Chitosanasecomplex structure [Pseudomonas sp. LL2(2010)],4OLT_B Chitosanase complex structure [Pseudomonas sp. LL2(2010)]
4QWP_A	2.21e-44	63	305	26	247	co-crystalstructure of chitosanase OU01 with substrate [Pseudomonas sp. A-01],4QWP_B co-crystal structure of chitosanase OU01 with substrate [Pseudomonas sp. A-01]
7C6C_A	9.58e-29	55	299	4	234	ChainA, Chitosanase [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P33665	1.16e-45	63	303	55	274	Chitosanase OS=Streptomyces sp. (strain N174) OX=69019 GN=csn PE=1 SV=1
P48846	4.12e-42	63	303	56	274	Chitosanase OS=Nocardioides sp. (strain N106) OX=47919 GN=csn PE=3 SV=1
O07921	1.13e-27	55	299	39	269	Chitosanase OS=Bacillus subtilis (strain 168) OX=224308 GN=csn PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000272	0.999022	0.000183	0.000194	0.000172	0.000148

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001437_01657.