CAZyme Information: MGYG000001437_01658

Basic Information

• Species: Staphylococcus schleiferi
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus schleiferi
• CAZyme ID: MGYG000001437_01658
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420	MGYG000001437_2|CGC4	47511.44	6.5594

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001437	2461191	Isolate	not provided	not provided

• Gene Location: Start: 318392; End: 319654 Strand: +

Full Sequence      

MKKTMLTSILAATTLLTLSLPAHSAHADEMGRLQTQGKEIQKDGQNFQLKGVNAGNVFTT
EKWMGGYPSAANINGGYKAVFDDIQSKVNSSEKAHQILDRYAHNRWDDQDFQNVKDMGCN
TIRLPINYINLTNYQKGMNPKDVKMRDHAFDEIDQFVAKAQQHGLYVILDMHGAPNSQNA
QEHSGEAQGDKSVGNFWNDPDAQGKTKEIWYYISQHYKNNNAIAGYDILNEPKGPAGHSD
GQVQQFYKDTLKTIRGNGDNHIAFLEAVWDPQNMKDPQYFGKNNNNIVYEYHNYPYGDGA
QSHKGIRENFDNKINSINKANYNVPSYMGEFNGNAATNDLHIAPNGNDFKYILKKMNESH
MSWSIWNYDKEGINQQDSSWGVENFKGIQTDINSNDFGKKEQPKKNETVFNAVKEAAQQS

Enzyme Prediction     

No EC number prediction in MGYG000001437_01658.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	92	368	1.6e-62	0.9619771863117871

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	3.04e-25	107	368	26	268	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	5.38e-20	108	369	76	363	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
COG3934	COG3934	0.001	104	383	25	293	Endo-1,4-beta-mannosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGS46457.1	0.0	1	420	1	420
QPA24418.1	0.0	1	420	1	420
QPA34648.1	0.0	1	420	1	420
CAD7358579.1	5.15e-310	1	405	1	405
AKS72584.1	5.16e-309	1	420	1	420

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3O6A_A	3.15e-15	37	308	2	268	F144Y/F258YDouble Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
4M80_A	5.66e-15	37	308	2	268	Thestructure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans at 1.85A resolution [Candida albicans SC5314],4M81_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with 1-fluoro-alpha-D-glucopyranoside (donor) and p-nitrophenyl beta-D-glucopyranoside (acceptor) at 1.86A resolution [Candida albicans SC5314],4M82_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with p-nitrophenyl-gentiobioside (product) at 1.6A resolution [Candida albicans SC5314]
2PB1_A	5.69e-15	37	308	3	269	Exo-B-(1,3)-Glucanasefrom Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PC8_A	5.69e-15	37	308	3	269	ChainA, Hypothetical protein XOG1 [Candida albicans]
2PF0_A	7.61e-15	37	308	3	269	ChainA, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
W8QRE4	3.69e-30	30	373	1	342	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
A1CRV0	4.10e-20	8	348	3	323	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2
Q8NKF9	3.92e-18	33	300	21	287	Glucan 1,3-beta-glucosidase OS=Candida oleophila OX=45573 GN=EXG1 PE=3 SV=1
A2RAR6	1.21e-17	11	294	6	270	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
Q96V64	2.33e-17	20	294	8	270	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000217	0.999036	0.000202	0.000195	0.000172	0.000151

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001437_01658.