CAZyme Information: MGYG000001437_01688

Basic Information

• Species: Staphylococcus schleiferi
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus schleiferi
• CAZyme ID: MGYG000001437_01688
• CAZy Family: GH101
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1467		163726.28	6.4813

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001437	2461191	Isolate	not provided	not provided

• Gene Location: Start: 351741; End: 356144 Strand: -

Full Sequence      

MIHRQQIFSIRKYAIGTSSILLGLTFFISASATASASELKNDLANQDTDVSPQATIDGHI
SKERLNASQTETKTADTQALGAQAISPTEQAKPQIDKTANSTAKMVSQNDSDSATKARTQ
PKQITQSKSSQNEQVHTQATSLSAKNAQNTSSLHAPVHHSDVVQAQPTTPSEAPLSHSPK
EMRRPQATAAPLSRQNQTATARKTNSSTHPQTTHIVSSLDTLQSQQMKVEVDQNFPAIKQ
YKLKNGKTIPGQVVDSSQIIVNGEIIKPTVSYKKLNDHTAEYILHAKDDNHAINSDFKFQ
LSVIDRTIDLKMTDYHSNNPDVIVRSFGFMNQSLVSVNSQQKQAQLQTTKMSTNTMVSGD
RLYTIDDKFEPNFSDMMMYGFVSNNQYSAGLWSNAQIGVGGNQDFIRVTATGVQTKEGVS
VGLGATPWILQPSLAHQDAKTQGLLPHIKIAIAEDENHDGKIDWQDGAIAYRDIMNNPFK
YEEVPDLVGYRIAMNFGSQAQNPFLKTLDGVKKFYLNTDGLGQSILLKGYNSEGHDSGHL
DYSHIGERMGGAEDLNTLLSIGAQYGARFGVHINASETYPESKAFNPDLLKKNEDGTYSY
GWNWLDQGFNINADYDLTHQRQARFQALKDVVGERLDFIYVDVWGNQQSGDNSAWPSHQL
AKEINDLGWRIGVEWGHGMEYDSTFQHWATDIAYGTYENKGINSEVARFIRNHQKDSWVA
NHAEHSGAADFPLLGGYNMKDFEGWQGRNDFKTYIKNIFDVDVPTKFLQHYKVMRIENGH
PVKMTANGRTIEWTPEMTVDLQNNTGDKVTVQRKSNDYENDINNYRSRTILLNGHTVLDG
DNYLIPWNWDANGQPLTGSEQKLYHWNKKGGSSSWELPDSWHTNQVILYELTETGRTNMK
IIPVTNNHIKLDHIKAETPYVIYQVPQPKQQEVNWSEGMHIKDAGFNSQKLDAWHISGDV
EQVGINQSVAHNHLLKIDSPKQKTQLTQQLTDLKPGQRYALYIGVDNRSKSQTQIAVSHQ
GQVLATNQTQQSIAQNYVKADAHNTSKASETYKDGGSYFQNMYLFFVAPQDGQVDFIISR
EAGKGATYLDDIRIVENPSILMRDGVFQQDFETVPQGLFPFVVSEFEGVEDNRTHLSEKN
APYTQRGWNHKRVDDVIQGHWSLKVNGQAGKNKMVIQTIPQNFYFEPGKTYEVSFDYESG
SDNSYAFAVGHDDISKNRNFKVTPLKNTIDHPHAQRVTFQVTGNENGQTWIGIYSTDVQP
DTRGVKDNGQVNFEGTKDFILDNLIIRPIDEVIDNNPSTDNPSHPSGDGSTDNTRLPNKP
TGQQIKQEPIGETAQSISPSHKVTTDQHESTTDNAQSSASTDTEISSAQQKQNGVATIST
DPSYVRTSTTISFENHGQVVKHTTQGTNTIIKASADQMRVEQLNAQLPDTGASSKTSTPP
LLMVMIGFFTTVLGLHHTRRKKQKQHS

Enzyme Prediction     

EC	3.2.1.97

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH101	224	924	0	0.9971711456859972

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam12905	Glyco_hydro_101	5.49e-157	465	755	1	273	Endo-alpha-N-acetylgalactosaminidase. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae is largely determined by the ability to degrade host glycoproteins and to metabolize the resultant carbohydrates. This family is the enzymatic region, EC:3.2.1.97, of the cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins. This reaction is exemplified by the S. pneumoniae protein Endo-alpha-N-acetylgalactosaminidase, where Asp764 is the catalytic nucleophile-base and Glu796 the catalytic proton donor.
cd14244	GH_101_like	1.16e-131	478	778	1	298	Endo-a-N-acetylgalactosaminidase and related glcyosyl hydrolases. This family contains the enzymatically active domain of cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins (EC:3.2.1.97). It has been classified as glycosyl hydrolase family 101 in the Cazy resource. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae and other commensal human bacteria is largely determined by their ability to degrade host glycoproteins and to metabolize the resultant carbohydrates.
pfam17974	GalBD_like	5.59e-84	1090	1275	1	190	Galactose-binding domain-like. Proteins containing a galactose-binding domain-like fold can be found in several different protein families, in both eukaryotes and prokaryotes. The common function of these domains is to bind to specific ligands, such as cell-surface-attached carbohydrate substrates for galactose oxidase and sialidase, phospholipids on the outer side of the mammalian cell membrane for coagulation factor Va, membrane-anchored ephrin for the Eph family of receptor tyrosine kinases, and a complex of broken single-stranded DNA and DNA polymerase beta for XRCC1. The structure of the galactose-binding domain-like members consists of a beta-sandwich, in which the strands making up the sheets exhibit a jellyroll fold.
pfam18080	Gal_mutarotas_3	3.91e-61	222	464	1	243	Galactose mutarotase-like fold domain. This domain is found in endo-alpha-N-acetylgalactosaminidase present in Streptococcus pneumoniae. Endo-alpha-N-acetylgalactosaminidase is a cell surface-anchored glycoside hydrolase involved in the breakdown of mucin type O-linked glycans. The domain, known as domain 2, exhibits strong structural similarlity to the galactose mutarotase-like fold but lacks the active site residues. Domains, found in a number of glycoside hydrolases, structurally similar to domain 2 confer stability to the multidomain architectures.
pfam17451	Glyco_hyd_101C	6.10e-38	762	897	2	111	Glycosyl hydrolase 101 beta sandwich domain. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae is largely determined by the ability to degrade host glycoproteins and to metabolize the resultant carbohydrates. This family is the enzymatic region, EC:3.2.1.97, of the cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins. This reaction is exemplified by a S. pneumoniae protein, where Asp764 is the catalytic nucleophile-base and Glu796 the catalytic proton donor. This domain represents C-terminal the beta sandwich domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD7358610.1	0.0	1	1467	1	1467
QPA34674.1	0.0	1	1467	1	1467
QPA24444.1	0.0	1	1467	1	1467
AKS66097.1	0.0	1	1467	1	1490
BAS45011.1	0.0	1	1467	1	1490

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6QFK_A	0.0	220	1290	10	1117	EngBFDARPin Fusion 4b G10 [Bifidobacterium longum]
6QEP_A	0.0	220	1290	10	1117	EngBFDARPin Fusion 4b H14 [Bifidobacterium longum]
6QEV_B	0.0	220	1290	10	1117	EngBFDARPin Fusion 4b B6 [Bifidobacterium longum]
5A59_A	0.0	220	1289	17	1103	Thestructure of GH101 E796Q mutant from Streptococcus pneumoniae TIGR4 in complex with T-antigen [Streptococcus pneumoniae TIGR4],5A5A_A The structure of GH101 E796Q mutant from Streptococcus pneumoniae TIGR4 in complex with PNP-T-antigen [Streptococcus pneumoniae TIGR4]
6QFO_A	0.0	220	1290	10	1117	EngBFDARPin Fusion 9b 3G124 [Bifidobacterium longum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2MGH6	0.0	220	1289	332	1418	Endo-alpha-N-acetylgalactosaminidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0368 PE=1 SV=1
Q8DR60	0.0	220	1289	332	1418	Endo-alpha-N-acetylgalactosaminidase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=spr0328 PE=1 SV=1
A9WNA0	1.79e-132	221	1289	51	1037	Putative endo-alpha-N-acetylgalactosaminidase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) OX=288705 GN=RSal33209_1326 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001499	0.997587	0.000276	0.000267	0.000188	0.000163

TMHMM  Annotations     

start	end
13	35
1436	1455