CAZyme Information: MGYG000001437_01762

Basic Information

• Species: Staphylococcus schleiferi
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus schleiferi
• CAZyme ID: MGYG000001437_01762
• CAZy Family: GT8
• CAZyme Description: Glycosyltransferase-stabilizing protein Gtf2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
449	MGYG000001437_2|CGC6	52412.2	6.1312

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001437	2461191	Isolate	not provided	not provided

• Gene Location: Start: 447675; End: 449024 Strand: +

Full Sequence      

MVNLFEHFDSETKALYDSLSLAGEQAPTIVLEDDGFLPEGMITPYQFFASYRAPKNGRPL
YFNAVPVPRFWEIEGNNEEAWVKDMSQKRAMIRYRPGEKRRHVSHVEWLNQQGKLQYVDH
YTQHGVLFAQTVYDLNRNMIFRRYFDQDGKDVIYYNFLAQSVVLNWKGEQYHFESHIAFL
TFFLEALEIDLSHFVVNSLGTPFSVLYYLNHTGQDVLYWQEYCKGNVPGNMELIFNNDTG
QRDFQIVVTHKEEYEAIAEAVSEDAREVIHDGGYLYQYEKTSTYQLQILTMTNTDQIHHI
ASIIESCPFATFHIGAVTEMSSVLTQLERYKNVRLYQAIELSTVEKLYQKCDIYLDINEG
GEIIDAVRKAFNYDMLILGYAAIAHNRTYTAPQNLFSKEDEAAALKQALRDVHLKKRYFK
VRQNYQKAHANEITVKQFKTIHQLAYGQK

Enzyme Prediction     

No EC number prediction in MGYG000001437_01762.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02919	TIGR02919	0.0	1	441	1	437	accessory Sec system glycosyltransferase GtfB. Members of this protein family are found only in Gram-positive bacteria of the Firmicutes lineage, including several species of Staphylococcus, Streptococcus, and Lactobacillus. [Protein fate, Protein modification and repair]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPA24509.1	0.0	1	449	1	449
QPA34739.1	0.0	1	449	1	449
QGS46369.1	0.0	1	449	1	449
CAD7358690.1	0.0	1	449	1	449
AKS66160.1	0.0	1	449	1	449

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5E9U_B	5.28e-88	2	435	2	434	Crystalstructure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii],5E9U_D Crystal structure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii],5E9U_F Crystal structure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii],5E9U_H Crystal structure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii]
5E9T_B	5.44e-88	2	435	2	434	Crystalstructure of GtfA/B complex [Streptococcus gordonii],5E9T_D Crystal structure of GtfA/B complex [Streptococcus gordonii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3S2Y1	9.78e-100	1	397	1	395	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase stabilizing protein GtfB OS=Streptococcus agalactiae OX=1311 GN=gtfB PE=1 SV=1
A0A0H2UR90	6.74e-98	1	412	1	413	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase stabilizing protein GtfB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtfB PE=1 SV=1
Q79T00	1.36e-92	1	448	1	448	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase stabilizing protein GtfB OS=Streptococcus gordonii OX=1302 GN=gtfB PE=1 SV=1
A1C3M0	1.51e-88	1	397	1	394	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase stabilizing protein GtfB OS=Streptococcus parasanguinis OX=1318 GN=gtfB PE=1 SV=1
A0A0S4NND9	1.20e-77	1	438	1	431	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase stabilizing protein GtfB OS=Limosilactobacillus reuteri (strain ATCC 53608) OX=927703 GN=gtfB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001437_01762.