CAZyme Information: MGYG000001437_01900

Basic Information

• Species: Staphylococcus schleiferi
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus schleiferi
• CAZyme ID: MGYG000001437_01900
• CAZy Family: GH23
• CAZyme Description: putative transglycosylase IsaA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
237		24721.7	5.7785

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001437	2461191	Isolate	not provided	not provided

• Gene Location: Start: 599988; End: 600701 Strand: -

Full Sequence      

MKKTLLASSLALALGTTGVALHSADANAAEENINKVELAQLALNNDQSLNEHAIEDGAYD
YHFTVNGVNFHFWSDGVTFGWSYGNGSGQEMAQSSVAQPTQMADYSAQASAHHGNNEASN
VQQSNYSAPAKQSAPSYQTSSTSTSSAGSVTLSNGNTAGSHGSRAAQILAQRTGVSASTW
EHIIARESNGQLNARNASGASGLFQTMPGWGPTNTFDQQVDAATKAYKAQGLSAWGM

Enzyme Prediction     

No EC number prediction in MGYG000001437_01900.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13925	RPF	1.44e-04	178	236	1	69	core lysozyme-like domain of resuscitation-promoting factor proteins. Resuscitation-promoting factor (RPF) proteins, found in various (G+C)-rich Gram-positive bacteria, act to reactivate cultures from stationary phase. This protein shares elements of the structural core of lysozyme and related proteins. Furthermore, it shares a conserved active site glutamate which is required for activity, and has a polysaccharide binding cleft that corresponds to the peptidoglycan binding cleft of lysozyme. Muralytic activity of Rpf in Micrococcus luteus correlates with resuscitation, supporting a mechanism dependent on cleavage of peptidoglycan by RPF.
cd00254	LT-like	0.005	183	211	7	35	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00442	Lyz-like	0.008	179	225	1	58	lysozyme-like domains. This family contains several members, including soluble lytic transglycosylases (SLT), goose egg-white lysozymes (GEWL), hen egg-white lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, chitosanases, and pesticin. Typical members are involved in the hydrolysis of beta-1,4- linked polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD7358830.1	6.04e-159	1	237	1	237
QGS46244.1	6.04e-159	1	237	1	237
QPA24632.1	6.04e-159	1	237	1	237
QPA34862.1	6.04e-159	1	237	1	237
AKS70642.1	2.36e-156	1	237	1	237

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2YWD9	7.64e-73	1	236	1	232	Probable transglycosylase IsaA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) OX=273036 GN=isaA PE=3 SV=1
Q2FDT8	8.78e-72	1	236	1	232	Probable transglycosylase IsaA OS=Staphylococcus aureus (strain USA300) OX=367830 GN=isaA PE=3 SV=1
A6QK59	8.78e-72	1	236	1	232	Probable transglycosylase IsaA OS=Staphylococcus aureus (strain Newman) OX=426430 GN=isaA PE=3 SV=1
Q2FV52	8.78e-72	1	236	1	232	Probable transglycosylase IsaA OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=isaA PE=1 SV=1
Q5HCY1	8.78e-72	1	236	1	232	Probable transglycosylase IsaA OS=Staphylococcus aureus (strain COL) OX=93062 GN=isaA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000364	0.998854	0.000185	0.000227	0.000191	0.000169

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001437_01900.