CAZyme Information: MGYG000001438_00804

Basic Information

• Species: Paenisporosarcina sp000411295
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_A; Planococcaceae; Paenisporosarcina; Paenisporosarcina sp000411295
• CAZyme ID: MGYG000001438_00804
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358	MGYG000001438_1|CGC5	39653.17	8.9302

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001438	3493887	Isolate	not provided	not provided

• Gene Location: Start: 796206; End: 797282 Strand: -

Full Sequence      

MKKKTIVLTGGGTAGHVSLNQAIIPTLEEQSFEIHYIGSKDGIELELIRDAFPHITYHAI
SSGKLRRYASVKNFTDPLRVMKGLLEALFILKKVKPSVIFSKGGFVSVPVVMAGKIANIP
VVIHESDVTPGLANKIAMPFAHHIFTVFQETLKHLPSEKSSCSGSIIRSELFEGRKETGM
RLCGFEGFKPVLLIMGGSQGSAVVNDAIRSNLPKLLEKYDVIHLCGKGKLDESLNNIRGY
KQYEYVTHELPDLLHAANIIISRAGSNSIFEFLALRKPMLLIPLTKLQSRGDQLLNAQIF
KKHGWASVIEEEEVTPASFMAALEDVKERTEHIQQVMESSEFPKTPNEMVSLITSYAK

Enzyme Prediction     

No EC number prediction in MGYG000001438_00804.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	192	340	1.7e-38	0.9363057324840764

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12446	PRK12446	4.37e-141	4	337	2	333	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed
PRK00726	murG	1.48e-121	3	340	1	335	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
COG0707	MurG	4.68e-101	4	340	1	335	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
cd03785	GT28_MurG	8.74e-101	6	326	2	321	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR01133	murG	3.77e-81	4	317	1	309	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBP41170.1	2.88e-199	1	358	1	358
AMO85567.1	3.01e-173	1	358	1	358
BAK16523.1	3.01e-173	1	358	1	358
QBK26008.1	2.86e-171	1	358	1	358
AMA63588.1	8.47e-171	1	358	1	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2U_A	2.69e-27	3	340	2	335	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	6.52e-26	4	315	7	311	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
7D1I_A	1.32e-22	2	316	8	323	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q97GY4	3.23e-128	1	358	1	356	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=murG PE=3 SV=1
Q893R7	3.59e-127	3	356	2	353	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium tetani (strain Massachusetts / E88) OX=212717 GN=murG PE=3 SV=2
A4IJS4	6.75e-127	3	358	2	356	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Geobacillus thermodenitrificans (strain NG80-2) OX=420246 GN=murG PE=3 SV=1
B2V1X5	4.13e-126	1	337	1	335	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium botulinum (strain Alaska E43 / Type E3) OX=508767 GN=murG PE=3 SV=1
Q0SRB4	3.24e-125	1	357	1	355	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001438_00804.