CAZyme Information: MGYG000001439_01441

Basic Information

• Species: Faecalimonas umbilicata
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Faecalimonas; Faecalimonas umbilicata
• CAZyme ID: MGYG000001439_01441
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
203	MGYG000001439_1|CGC11	22321.15	4.878

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001439	2968289	Isolate	not provided	not provided

• Gene Location: Start: 1396980; End: 1397591 Strand: -

Full Sequence      

MYKKRSEFKKIAAIAVGACGIAYGFGGAEVQAAPPEGGNWTLLPASSDEFDGDCLDENKW
TNGIWYDVTTDLAFCPENVSVRDGNLVLTAKKQDYNGKAYTAGAVESKFDVPGTASYVEV
RAKALDKKANVLSAIWMQSSPLSFELNPNPEIDIMETFDYTKMTSTIHTWNQSPSLHLQR
GTNGWKISVQTIIPMPLSGERER

Enzyme Prediction     

No EC number prediction in MGYG000001439_01441.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	47	175	3.4e-22	0.5869565217391305

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	4.06e-20	47	175	2	141	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd02178	GH16_beta_agarase	6.80e-20	33	184	12	168	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.
cd00413	Glyco_hydrolase_16	1.45e-15	48	175	1	125	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd02182	GH16_Strep_laminarinase_like	6.29e-06	47	157	7	136	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
COG2273	BglS	8.08e-05	44	171	43	174	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUC07808.1	2.03e-35	38	170	45	180
BDA64210.1	7.60e-35	38	170	44	179
QQO76836.1	3.02e-33	40	170	43	176
SNV18950.1	1.20e-31	37	192	48	203
QQM67290.1	9.27e-31	40	186	42	191

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XOF_A	4.56e-11	76	182	67	180	ChainA, GH16 family protein [uncultured bacterium]
6XQF_A	2.18e-10	76	182	67	180	ChainA, GH16 family protein [uncultured bacterium],6XQG_A Chain A, GH16 family protein [uncultured bacterium],6XQH_A Chain A, GH16 family protein [uncultured bacterium],6XQL_A Chain A, GH16 family protein [uncultured bacterium],6XQM_A Chain A, GH16 family protein [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q27082	1.00e-05	54	184	19	175	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000382	0.998813	0.000187	0.000230	0.000198	0.000164

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001439_01441.