CAZyme Information: MGYG000001439_01531

Basic Information

• Species: Faecalimonas umbilicata
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Faecalimonas; Faecalimonas umbilicata
• CAZyme ID: MGYG000001439_01531
• CAZy Family: GT51
• CAZyme Description: Monofunctional glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
232	MGYG000001439_1|CGC12	26755.77	5.2549

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001439	2968289	Isolate	not provided	not provided

• Gene Location: Start: 1486243; End: 1486941 Strand: -

Full Sequence      

MKRIRRILVGMLLIIVCAGGFVAGKGYRMYQEAMEEKSLVQIRKETVEDENFVSAEQLPD
IYKKAVVSVEDKRFYRHKGIDPIGIARAFYHNIRARKLLEGGSTITQQVAKNFYFDMDQT
VERKIAEIFMAIAMEKEFTKEEILELYVNHIYFGDGYDCVREASLGYFQKEPGQMNDYES
TLLAGIPNAPSVYAPTKNPELAKQRQQQVLETMVKNEMLTEEEQKEILTQAE

Enzyme Prediction     

No EC number prediction in MGYG000001439_01531.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	46	214	8.9e-61	0.9491525423728814

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	7.44e-78	42	214	5	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	9.67e-75	52	226	4	178	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	4.16e-67	47	226	73	253	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.43e-63	52	226	69	243	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK13481	PRK13481	8.40e-48	1	230	1	231	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU22158.1	1.68e-75	11	222	14	225
SET89048.1	2.46e-75	4	215	7	218
QUO38940.1	8.73e-75	1	228	1	232
ADL05597.1	2.17e-74	18	213	2	197
QRP41835.1	3.88e-74	11	222	14	225

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	3.03e-42	52	226	22	196	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	6.04e-42	52	226	22	196	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
5ZZK_A	1.52e-34	51	230	58	243	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	1.66e-34	51	230	22	207	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	1.70e-34	51	230	23	208	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0A0Z6	2.59e-38	52	230	70	248	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=mrcA PE=3 SV=1
P0A0Z5	2.59e-38	52	230	70	248	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=mrcA PE=3 SV=1
O05131	2.59e-38	52	230	70	248	Penicillin-binding protein 1A OS=Neisseria gonorrhoeae OX=485 GN=mrcA PE=1 SV=3
Q5FAC7	2.59e-38	52	230	70	248	Penicillin-binding protein 1A OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=mrcA PE=3 SV=3
Q07259	3.87e-38	51	214	48	210	Putative transglycosylase H16_A0665 OS=Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) OX=381666 GN=H16_A0665 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.681212	0.144655	0.170599	0.000618	0.000376	0.002540

TMHMM  Annotations     

start	end
7	24