CAZyme Information: MGYG000001440_01048

Basic Information

• Species: Acidaminococcus intestini
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Acidaminococcus; Acidaminococcus intestini
• CAZyme ID: MGYG000001440_01048
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377	MGYG000001440_1|CGC6	41202.39	9.1768

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001440	2243900	Isolate	not provided	not provided

• Gene Location: Start: 1135525; End: 1136658 Strand: -

Full Sequence      

MRIFISAGEASGDLHAAALTREILSLAPDAEVFGMGGDALRSAGGEVIFDYKDNSVMGFV
EVLRKLPDLFRLRDAFRQVMVERKPDIFVTVDYPDFNMRVAKVAKQLGIPVFSFIPPSAW
AWRRGRAKMVARLAARVACIYPFAYEVYKEAGAPVEFVGNPLVDIVKPTMSQLEAQKAVG
KRPGHPLILLLPGSRQGELRGVLPVMLEALPLIKKDQPDADFILQKAPNVDRRELEAALD
TSKIPVRIVEGHPYDTMGACDAALATSGTVVLEAALMDLPSVICYKASPISMAIAKALVK
VKYAGLPNLLAGREILPELIQEKMTPENMARHVLRFLDPAEGAKVHQDLREAIYKLGAPG
AVKRTAALILETAKEKK

Enzyme Prediction     

No EC number prediction in MGYG000001440_01048.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	3	351	8.4e-121	0.9774011299435028

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	3.53e-133	1	377	2	379	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	8.43e-119	1	375	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	9.37e-94	3	371	1	373	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK14089	PRK14089	8.09e-50	1	329	2	309	lipid-A-disaccharide synthase.
PRK01021	lpxB	1.40e-45	4	330	230	563	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEQ21864.1	1.48e-268	1	377	1	377
ADB48042.1	1.38e-188	2	375	3	376
BBG63223.1	8.56e-142	2	376	3	377
QNP77898.1	8.56e-142	2	376	3	377
QTV78315.1	1.17e-140	2	377	8	383

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.22e-54	1	373	7	381	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	3.37e-54	1	373	7	381	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q74AT9	1.35e-99	2	371	8	378	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q39T49	2.46e-97	2	377	8	384	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q1D393	8.66e-95	2	371	6	376	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
B3E4H8	1.01e-87	2	375	8	382	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q2IL69	2.86e-87	2	370	10	379	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000086	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001440_01048.