CAZyme Information: MGYG000001441_00183

Basic Information

• Species: Pauljensenia sp000411415
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Pauljensenia; Pauljensenia sp000411415
• CAZyme ID: MGYG000001441_00183
• CAZy Family: GT26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
261	MGYG000001441_1|CGC3	28367.99	4.881

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001441	2428388	Isolate	not provided	not provided

• Gene Location: Start: 225223; End: 226008 Strand: -

Full Sequence      

MTDQSTSADGPDYPEAAGEVGTLADPAFDAMAQRVLTRGHATTWLNHWSLLHADFRALAR
MNTVGFDGTLLQMRLRAAGHEVSRTSADLVLPHVFDRLDDGARITLIGAVPEAGQAAAER
LHRFDVQVIDGYEGLRRFKADPSVLTAFDPRLVIVGLGAGLQEVVASVALGLVPEASVCT
AGGWIDQYARAADDYFPDWVHAARLGWAWRIAHEPKRLTKRYTVEALDFVAHAPELISRL
EAMGSFDDLGLVVGPRSDAEE

Enzyme Prediction     

No EC number prediction in MGYG000001441_00183.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT26	59	221	5.3e-21	0.9824561403508771

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06533	Glyco_transf_WecG_TagA	2.85e-25	58	222	1	171	The glycosyltransferase WecG/TagA superfamily contains Escherichia coli WecG, Bacillus subtilis TagA and related proteins. E. coli WecG is believed to be a UDP-N-acetyl-D-mannosaminuronic acid transferase, and is involved in enterobacterial common antigen (eca) synthesis. B. subtilis TagA plays a key role in the Wall Teichoic Acid (WTA) biosynthetic pathway, catalyzing the transfer of N-acetylmannosamine to the C4 hydroxyl of a membrane-anchored N-acetylglucosaminyl diphospholipid to make ManNAc-beta-(1,4)-GlcNAc-pp-undecaprenyl. This is the first committed step in this pathway. Also included in this group is Xanthomonas campestris pv. campestris GumM, a glycosyltransferase participating in the biosynthesis of the exopolysaccharide xanthan.
pfam03808	Glyco_tran_WecB	8.62e-19	68	222	10	169	Glycosyl transferase WecB/TagA/CpsF family.
COG1922	WecG	2.15e-09	103	230	110	241	UDP-N-acetyl-D-mannosaminuronic acid transferase, WecB/TagA/CpsF family [Cell wall/membrane/envelope biogenesis].
TIGR00696	wecG_tagA_cpsF	1.36e-05	67	224	12	174	bacterial polymer biosynthesis proteins, WecB/TagA/CpsF family. The WecG member of this superfamily, believed to be UDP-N-acetyl-D-mannosaminuronic acid transferase, plays a role in enterobacterial common antigen (eca) synthesis in Escherichia coli. Another family member, the Bacillus subtilis TagA protein, is involved in the biosynthesis of the cell wall polymer poly(glycerol phosphate). The third family member, CpsF, CMP-N-acetylneuraminic acid synthetase has a role in the capsular polysaccharide biosynthesis pathway. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT35993.1	1.05e-162	1	254	4	258
QGS10589.1	1.01e-160	1	254	4	258
QQC43253.1	1.45e-138	26	253	15	242
AKU64534.1	1.45e-138	26	253	15	242
AOS47085.1	6.45e-96	31	252	19	239

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001441_00183.