CAZyme Information: MGYG000001441_00278

Basic Information

• Species: Pauljensenia sp000411415
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Pauljensenia; Pauljensenia sp000411415
• CAZyme ID: MGYG000001441_00278
• CAZy Family: GH111
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1232	MGYG000001441_1|CGC5	133310.62	4.4933

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001441	2428388	Isolate	not provided	not provided

• Gene Location: Start: 336706; End: 340404 Strand: -

Full Sequence      

MGTRPIIGALSAPILAATMLGLAPTAALAATETPYHPTVLWATSEEKVGESAPNGTIAAL
VDDDTTRTDATKTFWTTKWKGGLDEYPHALAVQNPTPGTQVCGLGLTPRPTYDSTLGNDQ
FPGEYRVFAFDEDPGNPAAEASFADWKTKVAAGTWDGGTEVAHGSDLQFGNKEQYVTFPA
TTKRVFTLTGLRSLAPGKKDMALSDIKLLPCDAEGNAITSYGSDDNSGNNTATRPVVPHP
EAPEQGSGASDLVVDFVIDQLPYGDPGKPVDFAPSTHTYTATGYYHATTVSARIRTVDGA
TVTINGATPDADGRVSNLDLTTGLNVITATVSKDGKEATYVVNITKVDTDFRGNVMVPVT
ATANGGTEADNAALTDLDPTTTWTSDPLVRANEWSDSVTGIELHLGEARYVHRVNGWGTP
TLPAGVQGWHGGNSVAIAVQEADGGPWKTIVTHGSLTRDARGLWYWDFNAYHLAKNIRIW
MNDETEPQTPQNIATAVTFNDVEVWGLPAGKTPVAPAVDNSMYERYSGFDPGEGKWGVNR
AQALALQYGVMMPAWVPSEGYGRGGFDANERDLTGGAFPMFYDLPMFNTPMMESLGKGAP
WALAKAPTGKNSMCNAGDPHDFMNEYMKPYASTLVDIQYGDEGGFNRVESECFKNWFSWS
KQNIPGAVVHANSWDDPSWYRDANLSYYVENAKPDLLSWDKYYWGANGGPAPSRVVMDLL
NTNTWKKQREYGLKGTTGDGSAPILYGQYLDYNWDANVSASEKSIVPSLGLATGQKWFGL
FRMEYNGYDRSSIIDHDGAPTRSFYEFSNIFGNVSYIGNYTKAMNSTFVAYKPGQYAARG
TTPSLSGYKYGDFASGDEAKAANEAVGLVDMSVTNVGSVNDGMPGDVVVGYFEQLKGLDS
AKSAEIFGDSTMAPKGFMVVNALTGQTHYPSYLLDPRTDNGSLAETAQDITLTVKKPSAN
AHLMLVNPADKTTQEVELGDGETSQVVLHAVGGGDSRFLYWVTIENPAPTPDPQPTPDPQ
PSVDPTPAPQPSVDPTPAPTPDPTPQPRTGQWKSGYFGWWYSYSDGTYAANETLVIDGFT
YRFDASGYLKMGWVYDGGHWYYHGASGAQQSGWIQDRGSWYYLDPATGQMATGWTQIGGT
WFYLSSSGVMRTGWVKDGGAWYYLSPSGSMVTGWQLLGGTWYHMGANGAMTTGWYQEGPT
WFYLRGNGSMATGWELIGWSWYHFAPSGAWIG

Enzyme Prediction     

No EC number prediction in MGYG000001441_00278.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH111	199	1012	0	0.7897286821705426

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033930	pneumo_PspA	9.92e-56	1025	1229	428	620	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	6.34e-51	1090	1228	485	622	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033838	PspC_subgroup_1	1.28e-46	1003	1229	416	643	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033930	pneumo_PspA	2.08e-41	1059	1211	492	643	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033840	PspC_relate_1	1.35e-39	1092	1231	511	647	PspC-related protein choline-binding protein 1. Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT36061.1	0.0	1	1100	1	1106
QGS10508.1	0.0	1	1100	1	1100
EDN79875.1	0.0	1	1100	1	1104
AKU64455.1	0.0	1	1127	1	1113
QQC43335.1	0.0	1	1127	1	1113

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000274	0.999004	0.000167	0.000214	0.000170	0.000149

TMHMM  Annotations     

start	end
7	29